__  __    __   __  _____      _            _          _____ _          _ _ 
 |  \/  |   \ \ / / |  __ \    (_)          | |        / ____| |        | | |
 | \  / |_ __\ V /  | |__) | __ ___   ____ _| |_ ___  | (___ | |__   ___| | |
 | |\/| | '__|> <   |  ___/ '__| \ \ / / _` | __/ _ \  \___ \| '_ \ / _ \ | |
 | |  | | |_ / . \  | |   | |  | |\ V / (_| | ||  __/  ____) | | | |  __/ | |
 |_|  |_|_(_)_/ \_\ |_|   |_|  |_| \_/ \__,_|\__\___| |_____/|_| |_|\___V 2.1
 if you need WebShell for Seo everyday contact me on Telegram
 Telegram Address : @jackleet
        
        
For_More_Tools: Telegram: @jackleet | Bulk Smtp support mail sender | Business Mail Collector | Mail Bouncer All Mail | Bulk Office Mail Validator | Html Letter private



Upload:

Command:

www-data@216.73.216.101: ~ $
ELF��@ @8	@@@@��888�������"`�`�`�TTTDDP�td$U$U$UT	T	Q�tdR�td���00/lib/ld-linux-aarch64.so.1GNU?��Ѧe�6y��DC'ʰ�#lGNU�d D��
 " DB( �� �aA��,�\�#a@�@(Ȃ0&
@�B  B�(�!���$�T�4Y 0 0�"ю$ X4��
&D����$��IO)�@ �,@@��	 �$E*� �
#a��@,Q:1@��� B1P����#�
`P%@E ���Rdefhknoqtuwyz{}������������������������������������������������������������������������

!"%&')*+./24578;<>@AEFGMRTUg�qI�?1N��j���~�I��q?���,�x��dC�09�c��bO?�ey�F�g`�3���8�/8�F 1�t�w"�\b��bG��3�j`���<\�.�y6�P�Wc��ߜ��TJ/����>~�(�]�d%#�%j	C�����;}	��[���㔠�۫�!j��j�ij��'�k>|�VL���m��z1��T�fO��T�W��4\�����)^V�hy�%�9���
:������m���r��@�I �ޕ̷����F�b��;�9��>���0y���f~�ZY��sTq�g�����* ڽ����{�2�[������Թ��O��%?�9�G(f5~W��yq�I���[E)��/1�ȉ���R����y��Ā�:]�$��:�
��O�'�
-��
|��!��wM�c��BE���!�D�H�ky���&�™a�`��7����/�T���m����z4����3E}[�f<xF�J$$9�Xŧ�±���+����>�+�O�>�>V-9��T3�_?���b]2�eC�^��U�.�
=�;�b�����5���3Y泙�"���2b��+k�+Wϖd7"�������Z��ѷw�_�X�y	�D�ɋC������ҷ����Ic+v�B~�Y��!;�8Y��\�/�2�'�~��c3��X|�Ι��ε�UE+�ȵ
w"�K�rn�=��mv�
5|E�:̳��|}%����������J�m�_��qX����}��ȿ�wT<���|j�|�Ӄs���DCq�*�ńM#�ԇ��C��iO̳��*$F���5(�
&�4�o��E�CC�AC�H$m��W�������ܦ#�#������J�S2��
����k� D[�����Ȩm���&�ȫ����VJs�6s�=�Y��9*�H8s�=�_�����-�����i�PD��� 5K	R"n{���k	��$��v�t�KD(;H��YW��
��~m ����)����"�:
=�\�!a��gw`R�je�� �@7.q����5���
��|
 ��Q
��\}
�:\
0�h�	
t�L�
����
Pn
0���

@�,@
`�P	
����	
��p
p��5

��	
���4

0|�	
`���
�5�c
�hV
`)H
�
���
�����	
�

�\�	
`&�]
��pn
�#t
 �8�	
�xJ

���
p��w

p���2
���
@3�d
 ���
�$x�

�
��
��.	
����6
��x	�
`x�
�,�

�3�
`�\�	
�/��
T��
@��M
p���
@��
�
Xq
P�>

@��[
���
p!�T
��,?

`��
`���
45D�	�p�

@�X�	
	8�
$��
T��

p��
��A
���	

����
���
���k

�.�}
�)H�
����

D�$�

�4�
����
p8	
`��i	
 % 
d-x�
0V@�	HpA	
���(
`�,�
���~
к�	
�.�	
��\4
��$�
@%�QP

@��

��� ��
�

h

��5
P4�
��h�
 ���
P�

 &<���
���C
@:t�
`� k
�'�|
�O
�<���
@/
p�h2
����

 
��{
p��Z��
ЙP
$��
@)�

Ŀ�v
`��
 @+
P�+
����
���

`��
���L
е�
P���
��H�

'�
��,P
d���
���Z
p���
@��IH
��F
ę�
��+

��D�
p���
�<
#��

02	
`��a
D��

�
�d�
���
�p
��N
XV

��E
��,

�44�
��q

p�P�
��kH
��!
�4@	
��$
 "
���
 ��
0��1
��[
��|�
���'
��\�
P9&
 .����	
���

P�`	�
PP�
p��	
�l�	
���
@
`B
�lY	
 �|8
P��B
���
0�h�
�c
������
�T����	X�
��S
�8���
0E�;
d9�
��h

���
��

,dp
�|�
� x�
d4sX�
�,�
���
�|v	
D��rXV
 Tp1
��(>
���	pp�
��G
 ���
`���
�SP�
�S�
`�L

p4L�

��
��Z

��U
��e
��9	
 ���
��&
���
���,

 �D�
�-8�h_ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__errno_locationlseek64setuidgetcglobfree64strcpysprintfstrncmpstrrchrwaitperror__isoc99_sscanfgetpwuidglob64signalstrncpyforksetreuid__stack_chk_failputcharreallocabortstdin_exitsocketpairstrduprewindstrtokstrtolfeofexeclpfgetsgetpwnamstrlenmemsetstrstrgetpagesizedup2vsnprintfstdoutfputcfseeko64fputsmemcpyfcloserandsetsockoptstrcatlstat64__ctype_b_locgetenvfstat64getservbynamestderrioctlseteuidrcmdgetuidreadlinkstrncatusleepfwritegettimeofdaygeteuidstrchrfdopenvalloc__cxa_finalizefcntl64memmoveunamefopen64setbufstrcmpstrerror__libc_start_mainferrorvfprintf__stack_chk_guardlibpthread.so.0libc.so.6ld-linux-aarch64.so.1write_xg1getnumfileopen64__libc_csu_finiusal_fprinterrusal_sprsenseusal_errflusherrmsgstrrequest_sense_busal_sprintresultusal__sprinterrusal__openread_g1scsidev_openusal_cmd_status__bss_start__mmc_capreserve_trackusal_getbufusal_printrdatascsi_flush_cachewait_unit_readyusal_smallocastolbread_session_offsetastollread_capacityrecovery_needed_io_glflag_fcons64is_unknown_devscsi_set_speedusal_remoteread_disk_infocfg_open_nixwriteusal_freebuf_edatausal_sensemsgsend_cue_sheetwrite_bufferqic02rols_getlinescsi_get_speedread_dvd_structureis_mmc_io_add_my_flagprint_capacityrols_fgetline__bss_end___io_set_my_flagusal_sense_qualusal_printwdatagetdevusal_settarget_badopusal_sprinterrlbuffermmc_checkusal_closeon_comerr_badfileusal_sense_keymode_sense_g0cdr_defaultscfg_get_nextprint_capabilitiesseterrno_nireadgeterrnousal_fprbytesscsi_cdr_writeusal_sprbytesastolusal_fprasciiusal_havebususal__errmsgusal_isatapi_badmodeget_mode_paramssaved_avseek_g0usal_setnonstderrsusal_bufsizecfg_closegetfilesmode_select_g0cfg_restartsaved_av0__usal_timesscsi_blankcdr_underrunscsi_loadusal_sprintstatususal_prbytesscsi_in_progressusal_getdmacntusal_printresult__data_startusal_getresidrr_goofscsi_load_unloadusal_printerrseek_scsiusal_sense_codereserve_tr_rzone_cvmod_fl_max_io_myflin_imagefillbytes__gmon_start__read_master_cueusal_versionread_buffer_IO_stdin_usedwrite_xg0read_trackinforead_rzone_infoscsi_compliantusal_cmd_errastollbsave_argsread_B0usal_filenomode_sense_sg0is_cddriveread_g0check_linux_26comerrno__libc_csu_initusal_prasciimmc_getval__usal_helpusal_std_opsusal_sprintwdata_endusal_cmdsaved_acprintinqusal_remote_opscfg_getlba_to_msfrezero_unitdo_inquiryusal_svtail_getargsusal_sense_tableread_scsifrom_bcd_io_get_my_flag__end__scsi_start_stop_unitusal_vsetupscsi_formatread_session_offset_philips__bss_startusal_sprintrdatausal_yesprint_min_atipmode_selectusal_dummy_opsusal_sprintcdbusal__closemovebytesusal_printcdbset_prognamereadsecsraisecondread_toc_philipsto_bcdscsi_close_tr_sessiontest_unit_readymode_sense_g1__roothandleread_cdtextscsidev_closescsi_prevent_removalread_tochdrusal_svheadfilewritesec_to_msfusal_fprsenseget_prognameallow_atapiastoiusal_initiator_idselect_secsizeblocksizestreqlusal_vheadread_subchannelwrite_xscsiusal_errfflushseek_g1scsi_set_streamingusal_printdevusal_fprintdevgetllnumilinemode_select_g1read_headersend_dvd_structuresense_secsizeread_track_infousal_natnamecomexitusal_sfreegetallargsmode_select_sg0request_senseerrmsgnoread_buff_capmode_senseusal_prsenseusal_settimeoutset_mode_paramsusal_sprasciisg_open_exclusal_resetmsf_to_lbaread_track_info_philipsusal_printstatususal_openusal_vtailscsi_unloadsend_opcusal_printfread_tocwrite_xg5GLIBC_2.17GLIBC_2.28GLIBC_2.27GLIBC_2.33� ���Z� ���Z����e���p���{���Z������@��H��P���X������������� ���(��0� �8�0�@���H���P���X���`�x�h���p���x��������������������������� ���0���@��H��X����� ���,��T���T��T�@��U�U � �(��,0���8�U@��TH�@�P�UX� Uh���x�H��h����� ���������p�SxpH�;��I��F��C��D�@D��B�B��A��A��@��3��3��3��34@4X4x4 �4(�40�48 5@H5H`5Px5X�5`�5hh�p��x�5���������@��p���������@��p���������6�06�P6x60�X��� ��(�60�8�@�H0�P�6X�6`H�hx�p�6x�������(��P���������������0���6�`������������(7@7 �@� `�(x�0��8�@�H�P(�X8�`P�h��p��x����0��P��x��`7��7��7��������������@���7�p�����7���� @�(80p�8��@��H�P(XX`�h�pxP8�0�h��������0�`��8��������8��8��8���8 9H9 h9(00`8�@�H�P0Xh`�h�px0��9�`����9��9�������:� :�8�X�x������		8	X	� 	�(	�0	8	H:@	(H	HP	pX	�`	�h	�p	`:x	��	�:�		�	0	�	P	�	x	�	�	�	�	�	�:�	�	�	
�	(
�	H
�	`
�	�
�	�
�	�:
;
�


0 
X(
x0
�8
8;@
`;H
�;P
�;X
�`
�h
p
8x
`�
��
��
��

�
8
�
�;�
P
�
h
�
�;�
�
�
<�
0<�
H<�
�
�
�
�
0h<�<�< X(�0�8�<@�<H�P�X`0h=ppx������ �@�h����������0�P�h������ = H=(@0X8x@�Hx=P�X�`h(pHxh���������� �8�P�x������=��=�>�(>�`>
p>
�>
�>
�> 
�(
�0
08
X@
�>H
?P
0?X
H?`
`?h
�?p
�?x
�?�
��
��
�?�
��
@�
 @�
�
(�
@@�
h@�
H�
`�
��
��
��
�@�@�@�@ 0(X0�8A@�H�P�X(A`h p@Ax@�p������P�������0�h������H����@x� �( 0`8�@�HP@Xx`�h�p8xx�����0 �p �� �� �!�P!��!��!�"�8"�p"��"��"�#H#x#�#�# $(@$0x$8�$@�$H %PX%X�%`�%h&p0&x`&��&��&�'�@'�x'��'��'� (�X(��(��(�)�8)�p)��)��) *hAP*x* �*(�*0�*8+@8+HX+Px+X�A`�Ah�+p�+x�A��A��+�B�,�(B�8B�,�@,�p,�`B��,��,�-�(-�P-�p-�-�-�-. 8.(xB0�B8h.@�.H�BP�BX�.`�.h�BpCx8C�`C��.�(/�h/��/��/��C��C�D� 0�P0��0��0��0�(D�181`1�1�1 �10@D8`D@xDH�DP�DX�D`�Dh�DpEx0E�HE��1�2�2�02�@2�X2�p2��2��2��2��2�3�03�P3x3h�_pp[xD_���@d��[�^��]��p��v� _��[��b��^��\��b�tb��p�^�^]] ](�p0 ]8�^@P\H�^P�\X�\`Pbh�pp�^x�^�]�]�]��p� ]��^�P\�T��0n� v�p���b��q�^��]� q\D\�p0] P\PXp�������!��.��5��6�W (0	8
@H
PX`hpx������������ �"�#�$�%&'() *(+0,8-@/H0P1X2`3h4p5x7�8�9�:�;�<�=�>�?�@�A�B�C�D�E�F�GHIJK L(M0N8O@PHQPRXS`ThUpVxX�Y�Z�[�\�]�^�_�`�a�b�c_$�{����P��{���_��{�����G��?� � � � ���@�� ���@�"� ���
@�B� ���@�b� ���@��� ���@��� ���@��� ���@��� ���"@�� ���&@�"� ���*@�B� ���.@�b� ���2@��� ���6@��� ���:@��� ���>@��� ���B@�� ���F@�"� ���J@�B� ���N@�b� ���R@��� ���V@��� ���Z@��� ���^@��� ���b@�� ���f@�"� ���j@�B� ���n@�b� ���r@��� ���v@��� ���z@��� ���~@��� ����@�� ����@�"� ����@�B� ����@�b� ����@��� ����@��� ����@��� ����@��� ����@�� ����@�"� ����@�B� ����@�b� ����@��� ����@��� ����@��� ����@��� ����@�� ����@�"� ����@�B� ����@�b� ����@��� ����@��� ����@��� ����@��� ����@�� ����@�"� ����@�B� ����@�b� ����@��� ����@��� ����@��� ����@��� ���A�� ���A�"� ���
A�B� ���A�b� ���A��� ���A��� ���A��� ���A��� ���"A�	� ���&A�"	� ���*A�B	� ���.A�b	� ���2A��	� ���6A��	� ���:A��	� ���>A��	� ���BA�
� ���FA�"
� ���JA�B
� ���NA�b
� ���RA��
� ���VA��
� ���ZA��
� ���^A��
� ���bA�� ���fA�"� ���jA�B� ��"Ѣ�{���B�G��S�Q�[�3 �����c��S�����#���8c�C@��?���)���/K��W��c��������������s��3��I���7�[@�@5�_@�@5�7@��W��3���"c������I� 5�F�`	�a���!�h�����aB� �`B�B��
����"�R�R����Ay Q? qx@z`B��T������WD9tB�`����V�Q������*��z����
���*|������B�@�����`B�D�`4���G��?D�@�B����	T�R�{@��SA��[B��cC��#@��"��_��;@������������I��4�3@��W@��@�!Q�W������a����7��������B �!@���`�G����R!������������R����7@���`��6�7@��� �]D��������������7@����;@�������!����D��d��3@���!��B@���D��\��RZ���!���3@����������!���D��O� � � � � � �_$��������@��#������G���c�G���G�+����������G�@�r���_�� ���! �?�T��!�G�a����_�� ���! �!�"��A��!�A�����B�G�b����_� �{��������`"Z9@5���G�����pA������� �R`"9�@��{¨�_� � ��� � � �{�����S����*�J������!�nD�s�G�"��!�Ҡ���c@�k���c@�b��!�Ҡ���e���c@����!�Ҡ�@�_���c@�B��!�Ҡ���Y���c@�B��!�Ҡ��
�S���c@�B��!�Ҡ���M����*o��� � �C2�����{���c�G��[��@��S��*����s��������*a@��G��ҡ�!��s����D���4�L�����#9��qM4T�c��������R�R�k��
)�{��q�D�b�R��R!��� x��9�6��� ������ �!��c@9b@9R����D���9�+���9��b@9c@9AQ!?dq�(TaQ!?dq(T`@9Q!?q�-T_Hq@
�R�`@z�*Ta@9?@qATb@9�2_`q�?@q�T�2_8q�?Lq�Tb@9�2_0q�?8q�Tb@9�2_4q�?q�Tb@9�2_0q�"@q�Tb@9�2B0q�?Hq�Tc@9�2q�?Pq�Tc@9�2q�?q�T`@9q�Tb@���9�c@���d@�!��U|@��
)�����D���9����9��a@9?@q�Tb@9B0Q�4?q�T`@90qAT�����x@�!����*���D���9�����9���5�D���a@9?LqT`@90q�Th@9�� ���;�Qx�?qMT@9`�* q�
T	Tq TqaT�#��3��������3@���! �i�*@yjh x @9 	9@9�*�5c6 @�!�9K�?q��T�#B95 �`@9��sK`Cz{ �mT�D�q��T�����@�����A��D� �#����:�r���B��@9@9�7�#��c���i�����R�c@�Ck x���5@9��#��c�W���@9�c@���@q�T�qT�#��3��	�T����D���c��3@���B�����+�a�=L@�B@y`�<�
�,i ���:�b	y�j�<`�<A���@��@9�*r!��T@9���#��3���5����3@���R#h x����#��3���-����3@���R#h x����;@��D���� @����D�B�����:����@���#��3��
�����D���)a��3@���c@���� @�I�k@���c@9Ki ���:�#9@����@����@��#�"�R����c|��`������K�5��M)"�R`� ������*��@���R����D���3��j!x��s�O)��?q$\zR��?jAT�cC��kD���@����9�!������D��D�!����3����s�cC����kD����G��GF�@�B���T�*�{@��SA��[B��sE��C2��_�`@9�{��������#���!��������D���9�����9�#9��.�����{@���3��*!�����*���9�!`�������R���c��k�9�����"�����
�Rƣ�r��{�����G��S�t@�#��R�?��Q�r3|@��D��@��W��Ҁ
D���R�Q�r�|@�Bƚc��K��ƚ�C�k	6T��!@�`��"D�$� �&@�A4T`�K��G����[��������c��R�k��s������c�������?@����R\@�?� �����"�R���Kә���t8�~@������4�7@�����x����D���9�Q���c�@� �;@��*z"@��g��*���� �k����D���;�D���`�*��! ����� �a����D���;�:���ff@9dE�R�B���$��R�����T����D���;�-���a�@9{��?�q(T?q`T�c@�q
TA4b�@9����B����@9�������<����a�@9K?k�T?8q
T�D���R�K�R�R ՙD�{�� x��9���� ���k��T�R8�R�g@�q@@z�
Tbf@9@�_jaTbn@9�5bj@9"5br@9_q�T�����!���������D���9���9��b�@9�jw8@@���!�Q`�!Kb7�!Q�R��u����D����B�R�D���9���k!x���9���5x4`f@9@7�c@��jw8!�c���~q
�T�?@��@�! ��?��G@���?@ ��T�[B��cC��kD��sE����G�@��������G��WD�@�B���AT�{@��SA���"��_քD�%�C@����98����@����������`@���B�����D�D@��D�@������n����@������D��=����<��9��k�<@��<����bf@99��@�_j��T�����!����������D���9�u���bn@99����4�����!���������D���9�h���bj@99��"�4�����!`���������D���9�[���9��e���*��;���!`�w����D�5�R��;�O���a��M��b�@9`@���B4_q�T�c@�q��T�����! ������R&@���!p@��p�8���{a@9`"@���!�K@��!�T��!���;��@� @��*!�@9�9�&���x���c@��Rq �T��`�����D��=����<��;��k�<�D����<B�����a������B�������RF@���;�Bp@��p����{b@9`"@���B�C@��"�T��B��@���;��*A�@9@@��9��x���c@��R��4��������D��=����<��;��k�<�D����<���D�`@9e"@��C@��|@�a�@�|$�B|�8���
����@�����\���D��*��������
D��D�J���[��c��k��s�^��� �{�����c�G��S��*�[���`@��k�YPS4@�@����a~u��R�*"�����T���*�������T`�����!@�&@��*�SA��[B��kD��{Ũ�_���c��*�XE��R��ZC�p@�!@�8|@����~�~@���lT�@����@����sҔ�sؚ�*����7�@�s �`4���?�`~����˵���T�*�SA��[B��cC��kD��{Ũ�_ր����?������@��?��� � �{�����!�G��S������#��� @��O��ҭ-����������W��@����R�R
�R��`Z� ��ҵ���t�*�`ZE��������@�!�R`ZE��b��B���B�u����`ZE���R�� 5bZE��A(@�!A(���!�G��O@�"@�c��ҁT�SA��@��{ʨ�_�`ZE�(@�!(���bZE� �RA(@�!QA(���#A9����8�?qB��B���������?������` ��?�`ZE�Y�������� ՠ��G�@�@�H����XE�M�{�������G��S����[������c����@�����Ҁ�� ��G����@�s����R'H�����w����� ՗����!��#�H������c�B�R�����*�/@�!@9?qA:�T�@�q�
T�#@����@��-T���&�H������c�V�qT�@���T�/@��lT ն��@��Cz�T�G����G���@�@�B���AT�SA��[B��cC��{ި�_֘�#!�������@����#��G����c������������!`!������*���#@�����Р"$�����������q�T�@�����T����!`$����#�@�@��q��T��!����������c�B�R@������/@�!@9?qA:*�T����!�"���*�#��c������������!`!�t����*q-T�����#@���x�������q�T��A9@4��@y����%�R?k`T������q�T�@����T����! %����#��G�@����� �RG���`
@9���5�"$�xG���������q�T�@����T����!&����#���Ay��AD�R_k�T������m����_G���������@��R8��U��R�#@�4��q
T�A9�4���c���B�R������/@�!@9?qA:kT1��T���#@�4��@9a�4���#@����#���������!�&����#��������!"�������R�#@�������!@#������ �{�������B�G���$@���E@�������q�T@9�5�`���!�G��@�"@�����T���@��{è�_����=�@9a5�@��"Q_�q�T?�q�R$Bz`T�@����c�'�cHb8bC�#�`��� ��������@�|����@��c����@9 ��q�RBz�T���4���@��c\X���@9����@��c�v���@9��@��c�b���@9��@�&���c|���@9��@��c�w���@9���@��c4N���@9���@��c�l���@9���@��c�u���@9��	����{����#�R��B�G�������D@������'�|���`����'@�B�G��@�C@�!��ҁT�@��{è�_��� � �{����#�R��B�G�������D@������'�`���`����'@�B�G��@�C@�!��ҁT�@��{è�_���� � �{���������#�q`T`*@�q�T�R�@��{¨�_���="�������#�qa��T���#�q@T���#�q�T���#� q�T � �R��{���������#�q T���#�q�T�R�@��{¨�_����#��q�T���#�0q���T���#�$q���@��{¨�_����#��5 �R�@��{¨�_����#�qa��T��� � �{���R�R���S���$@���>����`*@�A��
���@yq`@�A�Rc��RB���`4*�
)��y��!�(�a*����SA��{¨" �{�����S���$@������6�&@��R?q�T�SA��{¨�_���5#�qT�������7 �R�SA��{¨�_���'#��6$�R��r�������������6��!#�1T��#�q���SA��{¨�_���7#�q���� � �{�����[��*(@��S���!(����� �7a*@� �R!Qa*��SA��[B��{Ĩ�_�������a*@�!Q�6���R�R�qT/q�T �R���k�T��������*���6a&@�"X@y��7#��*���"�q���T��q�Wza��T`*@�qmTQ�R�@�a*��SA��[B��{Ĩ�_�a*@� �R�@�!Qa*��SA��[B��{Ĩ�_�a*@�!Q�@�a*��R�SA��[B��{Ĩ�_���T!�`*@�� �Ra*���� � �{���R�R���S���$@���T=����A��@�����@ya@���c��B�(���!S!2!*��yb*��SA��{¨a!�{�����R���S��� �G��R�&@������@��'�����1=�A����a��@��a��D�Rc�@y�@���cB)�u���!Sdr9!2!*a�y�*�=!���7����B�R�*AK��A"��R��!�G��'@�"@�c����T�SA��@��{Ũ�_���z��� �{�����S���$@��[��*�����R�R�<����b�@y@��`
�c�RB�@���v�)�u)!Sur9!*!*a�y�*���!�|�SA��[B��{è�_�{�����S����[����*�&@��*���R�<��R�R���<����a�@y@��`
�D�R!�@�c�Rv���u)@)��4*ur9B*b�y�*���� �`�7�.@��5�SA��[B��{è�_��������K��`)���R�SA��[B��{è�_����{���R�R���S���$@����<���A��b��A��`r@������@ya@���Rc��B�)����4*��x!*��yb*���� �@�7ar@��R#@)c�ZB�Z#)�SA��{¨�_������{�����Bg����S��������@g��r@�n������!*�b@)�A���CbabB|@�B�c(e!b!c `"b#x�Dx�dx������r@����SA���{¨!+�B��|���{���R���S���$@����*�R��M<����b�@y@��`
��q��R�@�B��C�R!c��4*an9*`�y�9��`+��*���W �|�SA��@��{è�_� �{���R���S���$@����*�R��&<���҃�@y@��
�c�a@�@�R��B�+�����!S�r9!2!*��yb*�3 �|�SA��@��{è�_� �{�����S���$@��[��*�*�R�����*�R�;����c�@y@��`
��qd�R�@����qc���4*!**B�Rb�`�yar9�4`fA92`f9��@,��[B��@��*����SA��{Ĩ �{�����S���$@��[��*���R�R���;����C�R@��`
�"	��Ё.@��,�v�u)bb9u�9�9�*�5����|�SA��[B��{è�_֣�b��!�Ҁ�c�G��,�c@�v�������|�SA��[B��{è�_� � �{�����S��*$@��[��*�*�R�R�������;����A�R@��`
���a�`b9�@���7afA9�>H��bj9vn93af9��7�>HӵafA9�`r9���*tf9uv9 -��*�����|�SA��[B��@��{Ĩ�_�afA9��R�*bj9vn93af9��6��R�*� � �{���R���S���$@����*�R��b;����A����a��c�@y�@���Rcuj9�@��4*!*�a�y��B`-��*����SA��{èm�{�����S���$@��[������R���c����*�R>;���ҢRP�@��`
�C�R��Z�@�b *��!�-�x�@4*v)`�y��u�ywr9�*�K� �7�����K�SA��[B��cC��{Ĩ�_������{�����S���$@��[�����Z���c������R�R;��
�Z@��b�@y@��`
�D�RB�@�C�R��!�-�x��4*u)*`�yw����v�x�*�� �7�����K�SA��[B��cC��{Ĩ�_������S@�_�LT������{�����S���$@��[�����Z���c������R�R�:��
�Z���b�@y@��`
�D�RB�@�C�R��!.�x��4*u)*`�yw����v���*��� �7�����K�SA��[B��cC��{Ĩ�_������{���R����$@��S��������R�:���҂RP�@��
�c�R��Za@�b *@�R����y��A4*��y@.��@�`*����SA��{è��{���R���S���$@������R���:�@�҂�@y@��
�c�RB`@��
�ZA�R�������`4**��y `.��@�`*����SA��{è��S@�?�LT����� � �{���R���S���$@����*�R��j:�A��@��A��������R�B���@y`@�!@4**��y�4�fA92�f9���.�`*���t�|�SA��@��{è�_� � �{�����S�t$@��[����*���R�����R?:�@����Z@��`
�`�@y$�R�@���w�v)B�.�!Sc�x!2!*a�y�@�!<HӔ*tf9�SA��*����[B��{ĨD�{�����S���$@��[���v���c����*�R�#����R:�y�@�҄�P��P���ZF�Re�R��Z@���!/�w)`
���eb9vf9xj9dn9t�ycz9b�x�*��� *�SA�|S�[B��cC��#@��{Ũ�_�{�����S���$@��[��*�*���R�c��*�*�k����*�R�9�@��b�@y@��`
�C�RB�@�a�Rz�u)`4**`�y�4`fA9!�R 3`f9x4�R`j9��Zwn9vz9��u�x@/��*�����|�SA��[B��cC��kD��{Ũ�_�{�����S���$@��[��*�*���c��*�*�R�#����R�9�@��b�@y@��`
�c�RB�@�a�Ry�u)`4**`�y�4`fA9!�R 3`f9���Z��!�/�vj9��wz9u�x�*���|�SA��[B��cC��#@��{Ũ�_�{�����S���$@��[��*�*���c��*�*�R�#����Rx9�a��@��A����a��a�R`B�b�@y�@�By�u
� 4**`�y�4`fA9!�R 3`f9��Zwz9u�x�6`�A92`�9�6`�A9`2`�9���/��*���t�|�SA��[B��cC��#@��{Ũ�_�{�����S���$@��[��*�����R�c����*�R>9�@��b�@y@��`
���RB�@�a�Rx�u)`4**`�y�4`fA9!�R 3`f9�
�Z��Zv����u�x�/��*���C�|�SA��[B��cC��{Ĩ�_�{�����S���$@��[��*�����R�R9�a��@��A����a��%
�R`B���Zc�@y���@�B0�cv�u
����4*d�x!*a�y�*��|�SA��[B��{è�_� �{�����S���$@��[��*u�Z���c����*�R�R�8�x�`��D����Z��C
�R@���!@0�v
�`����dB�cb9wf9u��b�x�*���|�SA��[B��cC��{Ĩ�_�{���R���S���$@������R���8�@�҂�@y@��
�c
�RB`@��
�ZA�R�������`4**��y �0�`*�����|�SA��@��{è�_� �{�����S���$@��[��*�����R�R�8�v�`��D�Ң�Z��C
�R@���!@0�u
�`����dB�cZ��yb�x�*���|�SA��[B��{è�_� �{���R���S���$@������R��z8�@��A��@��a��c�@y�@�d
�Rc�
�Z��B�0��4*�!*a�yu�����*���|�SA��@��{è�_� �{�����S���$@��[��*u�Z���R�c��*�*�#����RP8�a��@�ҁ����a����R`B���Zb�@y���@�! 1�By�v
��4*u��*`�yxz9��w~9c�y�*�W�|�SA��[B��cC��#@��{Ũ�_�{�����S���$@��[��*�*���R�����R"8�A��@�ҁ����a����R`B��~c�@y��Z�@���cA�1�w��4*u
�*`�yez9��v~9d�y�*�)�|�SA��[B��@��{Ĩ�_� � �{�����S���$@��[��*�����R�R���*�7�A��@��A����a���q`B���b�@y�
�R�@�# *B��Zv���`4*u
�*`�yd�x �1��*�����|�SA��[B��@��{Ĩ�_�{�����S���$@��[��*�*���R�����R�7��
�Z@��b�@y@��`
���RB�@�a�R��Zw�v)���4*!@0�*`�yu����c�x�*���|�SA��[B��@��{Ĩ�_� �{�����S���$@��[��*�*���R���*�R�7�A��@��A��<��a��a�R`B�c�@y�@�cwj9vv9 4**`�y�4`fA92`f9�� 2��*�����|�SA��[B��@��{Ĩ�_�{�����S���$@��[��*�*���R�����Ro7�@��b�@y@��`
�%�RB�@���Zd�R��!�2�w��4*u)*`�yvr9��c�x�*�z�|�SA��[B��@��{Ĩ�_�{�����S����R$@��[��������RH7�@��b�@y@��`
���RB�@���ZD�R��!�2�v��4*t)*`�yc�x���*�T���7`"@��K�SA��[B��{è�_����� � �{�����c�G��S����[����R$@������R`@��/�����7����@��a��@��a����Rb�@y�@��#�B��R��!3��4*`�c*c�ye�x���*�"�@�7��I)�
�Zs
�ZV����.@�����4����J�@3�a�J���Ru��ˁ�R`�`��~�՚kЁq����!�G��/@�"@�c���aT�SA��[B��@��{ƨ�_�`��5V������I�{�����S��*�R$@��[������R�����*�6���@ys!�R�
�Z3 *Hs*A��@�ҁ��������B���y����4�fA92�f9���3��SA��@��*����[B��{Ĩ� � �{�������G��S����[����*�c��*$@��@��7��Ҁ�4�+����R�R�6�C��@�҃�� �R����!`4�v�u
�c��`B���b�y�4�v9�*�������*���*5���1TW5��6��#�ԐR�'�z��R�����R֢6��C��R��R7�r'��q`�@z�T��V�����B�R��Z�����@y���s�Zs>�*b~@"(�"[��*9��Rk
��T@�R�����7�Q��R+�R�1T���5��5�����6 � �R����/������7���G��7@�@�B���aT�*�SA��[B��cC��{Ǩ�_ր��5������#��'��� �{�����S���$@��[��*���R�R���c��*�*6����a�@y@��`
���R!�@�C�Rv��u)�4**`�y5qafA9���.@�br9lS3af9�4���B�8��G�@���!�8����*��9�U���@9��[B��cC��*����SA��{Ĩ`fA9#�R�.@�br9`3`f9!��4���B�8��G�@�� � �{�����S���$@��[����*�R�R���c��*�*�5�@��a�@y@��`
��
�R!�@�B�Rv�u
)`4**`�y�5qafA9���.@���Zc�xlS3af9b4��!�8����8������*��9�����9��[B��cC��*����SA��{Ĩ�`fA9"�R�.@���Zc�x@3`f9��4��!�8���{�������G��S��*�@�����BQ_�q(T�[������c��*�*xq�T�.@��@x�@9��y�y��y�9�9 5�*�*�*���������[B��cC���!�G��@�"@�c���AT�SA��{ը�_�xbQ�#����9���*�����9�������[��c��� � ե���J�E5)������{�����S���$@��[��*�*�d3�R���c����R=5����b�@y@��`
�D�RB�@�c�R��!@:�w��4*v)*`�yuj9��vr9�*�I���7�.@��5�SA��[B��cC��{Ĩ�_��������K���:�~��R�SA��[B��cC��{Ĩ�_��� �{�����S���$@��[��*�*�d3�R���c����R5�@��b�@y@��`
�E�RB�@���Zd�R��!�:�w��4*v)*`�yuj9��c�x�*�
���7�.@��5�SA��[B��cC��{Ĩ�_��������K���:�B��R�SA��[B��cC��{Ĩ�_��� �{�����B�G��S��*(@�C@�������!(����45�R��a*@����G�!QT�
�a*��@�@�B��ҁT�SA��{Ө�_������R��R�R����`��6�!��{�������G��S��*�@�����BQ_�q�
T�[������R����� �R�c��*�*�4�qbBē���*�*��~�����7��W�sKq,T�@y�RB�ZB<r�T�@y�@y�Z�9�x�9�.@�`5�[B��cC���!�G��@�"@�c����T�SA��{ը�_�_qlT@�R_qBЀ�@yA�@y�Z�9�x�9�.@��4�*����;����R�[B��cC��bQ���#��8���BQA���[B��cC�����[��c�������J�E5�������{�����B�G��[����S��*��J�A@����ҿk�T(@���!(�E���S5�R�*@���
�Q�*����G��@�@�B���T�*�SA��[B��{Ԩ�_�������R��R�R	���@��6��� �{�����!�G��S����[��#��������R @����� �R��4��&@��R�R���3����@��a��@��a��e�Rc�@y�@���Rc��B�/�u��4*j9!*a�y�y��d�9�*����7�@y��Z<q	Tw��+A9���Rv��/A9�����G��@�@�B����T�*�SA��[B��@��{ը�_ր*@�� ��5�*��!�;��3��7� � �
��c,˃��R �R�{���c�G��S����������d@��'��Ұ3��&@��R�R���3����@��a��@��a��d�Rb�@y�@���RB��Ra�!�/��4*u�*`�yej9���yc�9�*����7�s@y���`��;�s�Zs>s
�*���*������R�R�R���@�7a�`�! =�@=��9��*���9��R��!�G��'T�"@�c���AT
��{@��SA��@��c,��_ր*@��4�.@�q�Ta��!@<�3����*@����5a��!�<�3������{�������G��S����[��*���c�������k��R���s� �R���7��z��@�������>3�t&@��R�R��93����@��a��@���f�R��@ya@�C�/�B��R�����4*�j9!*��y�z9��xc*�D���7��@y�7@��Z<,qiT���@��Z|@������?@��lӀ����?@��hӀ�w�`*@�$�R�*��`*��R����RH���@�7�B9�Hx�y�
9`*@�Q`*��
���q�T�R �R���2�e*@����@��e*����R�R����`�7��A9!��R`*@�Q`*����G��@�@�B���	T�*�SA��[B��cC��kD��sE��{ب�_���R ��t&@��R�RZ�/����2����@��a��@���d�R��@ya@���RB���j9���4*�z9!*��y��xz*���`�7�@����Z|@�/
�������*����R���� ��7�B9!����R����y�
9�������`*@��q��T�*a�!�=�T2����
� ���c,˄�{�����G��S��c��[����*�c��R���@��/�������R�2�����E�R�R��R"�R�`�7�@y��Z�>�
�:q�
T�*����E�R�R"�R���	�7�.@��k��*y��5`�?�T�oA9s�`@9k�T`@9�q!T�.@�@
5`@9v4���*`@9���*`@9���*�*�*#�R��X���.@��5`"@9�4���*`&@9���*`*@9�*���*�*�*#�R�����.@��5�R7��kD�����!�G��/P�"@�c���A	T��{@��SA��[B��cC��c,��_�s.����T�kD���b@9#�Ra@9����b*@9#�Ra&@9�����.@����4��`��>���R7����kD������R��@Kk�T�*��`�t��=�`�?��Tz�Z#>� ������.�b�RV���C��T�����`�b�R@>�N������`�`>����������TK���k�R� �{�����B�G��S����[������A@��������R �R�1�t&@��R�R���1����@��a��@���d�R��@y`@�%�RB��Ra�!�/��4*��*��y�j9����y��9a*����7`.@� 5�s@y��Z�>�
�q�T�*����%�R�R�R���7`.@�@5�R���C@�!�Z����!�G��@�"@�c��ҁT�SA��[B��{Ԩ�_���X�a��RBK �>���������O����K`��>����a��! ?�51������ �{�����B�G��S������������A@������R �Re1�����%�R�R��R�R��� �7�s@yc�Zc<cq�T����%�R�R�R�����7�Rs���@9������!Q��!|}�cha8Bha8�ha8c<S�ha8b *B*!SB|@�B�b���!�G��@�"@�c���aT�SA��@��{Ԩ�_�a��! ?��0����� �{�����B�G��S��*(@����[��#�!����C@�����(�+�a*@��R��!Qa*� �R1�`*@��q��J���`*��zS��R�*��R�5����������7�/A9� q�T���R �R�0�`&@��5`*@�Q��`*�!�G��@�"@���ҁ
T�*�SA��[B��@��{ը�_�����8���`��6�R �R���0���J��*���R��R�5���������6`*@����`&@��5�GA9�R�KA9�OA9<S *���* �R�0�`&@����4��J��*����R��R5��q������7�#A9�3��/A9����@�������T���b��@9��!���@9!�������T@�R������������6�������7��3A9`��?����7A9`��;A9�?��?A9B<SA *!*!|@����GA9���KA9��OA9B<SA *!*!|@���������{�����B�G��S��*�������A@��7���h��R��R��p0��n@�b~�Rs�Z��9���9�y!�J�@�lX�q䗟!5�����R��R9�����!�G��7@�"@�c���aT�SA��@��{Ǩ�_������R��R������� � �l@�@9q���_� � �@@�q���_�{�����S���p@��[���t&@��*@�����q-T���R�R+0�`r@����C��RPӵ�Zb�R@�!S�
�!2��c@�|����y��!4*��y�r9B���[B��@��
�b*����SA��{Ĩ/������[5��� �{�����S���p@��[����&@��*@�����qMT���R�R�/��r@�A��A��c�@y�R��Z@�ca
��
�Zf�Rw��@���|d�x�@��4*!*`)a�yB�u�����[B��*��SA��{Ĩ�������&5����S@��q@�G��*�������T���J��4�*�������������{����"����S���a�l@�  �!��y�����R��
@9��a�!��B���@���a�!��BlX����@�lX�q�T�@9xqhT�"@9@4�"���a�!����B���a�!����������SA�a�{¨!����B@9���5��@9���5�SA��{¨�_���`�"��@�!��C��@9@	87 
07�@9�87�07@(7 7�7�7�7��@�R}�����`������!��.��@9��6��`�B��!����&����`������!����@9��6���`���`�!����@9`�6���`����@�!��
��@9 �'6���`���� �!����@9�/6���`�����!����@9��76���`�����!�����@9 �76��`���!����������{��a������ ��*�aB@�?�
q�T?�q�T �Q q)	T`� ���@�`�{¨���?q�T�T?,q�TMT?�q�T?DqT`��	�
��?q`T�T?q�T?qaT`�`���?�q���T`�`	�����?$q@T?(qaT`�`�����?q��T`�������?qT?qaT`�`�����? qA��T`�����������5`����������B�	�BH`8`�"�@�`� 	������`��
������`� 
������`��������`�`������`�������`��������`�`������`��������`� ������`��������`�`������`� ������`�����~��`�����z��`� ���v��`��
���r��`��
���n��`�`
���j��`�
���f��`�����b��`� �}�^��`���y�Z��`�`�u�V��`��q�R��`��
�m�N��`��i�J��`� �e�F��`� �a�B��`���]�>��`��	�Y�:��`���U�6��`���Q�2���{����(@��S���!(�$@�3�a*@�!Qa*���6�&@��R?qT�@�!�x�?�q�T��@9@q���SA��{¨�_��R�SA��{¨�_�{�����S��� @������x7 @�t&@���7�R�R��.���ҁ�@y@��
�c�R!`@�D�Rb�R���r9`4**��y`�@,�`*���'���6����RK��4�R�*�SA��@��{è�_���R��*���*o�
qT�q�R�Az�T�
@�`�b���B��a�q�!��B���*�-��*a�!���-��*�SA��@��{è�_��R�R���-���ҁ�@y@��
�c�R!`@�D�Rb�R���r9`4**��y<H�2�f9������ � �{�����S���$@�a� @� �7���R�R�-����a�@y@��`
�c�R!�@�B�Rb�br9`4**`�y`�@,��*����SA��{¨����R�R�-����a�@y@��`
�c�R!�@�B�Rb�br9`4**`�y<H�2`f9`�@,��*����SA��{¨� �e��{������B�G��S����[��#�u��������@@�����	����q�T����R��`4�R �R��g-���������������A�R.	�`��4�G@�a4�/A9@@�����@9<q�T�@y�ZQ<�q�T�@y�ZQ<�q	T!Q3K�G����*�����1���`~@�`����� ��ҁ�!�G��@�"@�c���T�SA��[B��@��{ը�_֟� � �{������d�G��S�(@�����c���@�����(����������a*@�!Qa*�����@y!�Z!<��@9?lqHT(@y!�Z!<�RT�����!�G��@�"@�c���aT�SA��@��{Ԩ�_�8@y!�Z!<���h�@9��@9(�b��A���@9!A�a�d��AӇ�@�#t]�!p\�%�@9E�D�BC�_+������+�����_��	ч��{�����G��S���l@��@��7���@9�R�q�T��!�G��7A�"@�c��ҁ	T�{@��SA���	��_�s������k���� �R�����[������R�c������,�|�J�a*@��q�T!a*����������R��R�R����a*@�� *|S`�
�a*����������a*@�`�J�!Qa*��k�T�*�������R:������������������� �R�[B��cC��kD��sE����!��[B��cC��kD��sE�����[��c��k��s����{������B�G��S����[��*��Rl@�@@�������R��u&@�\,�b*@���B�Bb*�j��&@�q�T�Z@y�
6�R@�qM
T������R�c��k��+�g���6`.@��*5�Z@y�
7�C��R�R�"���������5�������1����������-���9��9�@9�#9A?q-T�T�(4?q�T`B@��q AT�@9�5��9��6�
@9q!T`�����RaB��=�<���<`Ӏ<`*@�Q`*��#4`B@��*`*4����!�G�!@�D��� �R�cC��kD��+@�"����a.@���R8K�4�@9_|q/T`�� ��C�����@ku8�QB_xqIT��R���?k�T5�R@�R����a*@��R!Qa*���!�G���@�"@�c���VT�SA��[B��{ڨ�_֠R@�q�+T�C��R�R����C�5�R���?qTa���!�����3Ta���!@���?��1Ta���!����?�2Ta���!���?�%Ta���!`���?�6Ta���! ���?�Ta���!`���?�CTa���!����?�`2Ta���!��z�?�@8Ta���!�t�?�7Ta���! �n�?�6Ta���!@�h�?�6Ta���!@�b�?�DTa���!  �\�?��FTa���!!�V�?�@ITa���!`!�P�?��KTa���!�!�J�?�LTa���!@"�D�?�NTa���!�#�>�?��LTa���!��8�?�VTa���!�$�2�?�@TTa���!�$�,�?�\Ta���! %�&�?�\Ta���!�%� �?� ZTa���!�%��?� WTa���!@&��?�STa���!�&��?��KT �`B@�`�5a���!�'�����#TZ_qA�T�>�R`B������������������)�
)�)<���`4�>�R`B��g@�`4�>�R`B��o@�`4�>�R`B��s@�`4?�R`B��w@���4 ?�R`B��?q��T K�R`B�`*@�Q`*���5 �R�cC��kD��+@����&@�`УR@�@��@�D�x�B�a�������@9 5�"@9 4�qmT��R�9�����!�_�@T @9�Qxq)��T�9`B@��4q`T�Tq!T`���=�<���<`Ӏ<���a���!�'���?�a�TK�R`B�����cC��kD��+@����@9���4 �xq�Ta���!���?�Ta���!@���?�#Ta���!����?�#T`�R`B����5�4`�����RaB��=�<���<`Ӏ<`*@�Q`*���5���@�R`B�y��a���! �k�����T@@�R`B�p���C�B������ 
�6��`� ������u&@�����R�R��X��p*�������R��@ya@�@�RB���j9y�A7*9c-�!*��yy*����u&@��R�R��Z*����#�R��@ya@���B���j9A7*!*��yy*�m��	�7�@y��RaB��C�$�RD2�R�y��q��T`����=�<���<`Ӏ<'��q��T`���=�<���<`Ӏ<��a���!`�����T�D�R`B��� 2�R`B�a��a���!������T�D�R`B�	��`���=�<���<`Ӏ<���@9���	���a�99K  ��?q��T ��a���!�������T ՀC�R`B�� �R�C��R�R`B����a���!������Ta���!�������Ta���!������TF�R`B���`����=�<���<`Ӏ<��a���! ������T �R`B����a���!`�����
Ta���!�������	Ta���!������Ta���!����� 	Ta���! �����Ta���!@����� 	Ta���!`�����Ta���!�������Ta���!������Ta���!��}���Ta���!�w���a�T`@�R`B�|��a���!`�n���A�T��R`B�s��@�R`B�p��a���!��b����T�W�R`B�g���?�R`B����@�R`B����@�R`B����`@�R`B���@@�R`B���@@�R`B���� @�R`B����A@�RaB�a�!�C���a��T���?�R`B����a���!��9���Ta���!��3���Ta���!��-���Ta���! �'���a�T[��a���!@ � ���Ta���!� ����Ta���!� ������T�H�R`B����c��k��+���a���! !����Ta���!@!���롾�T���F�RaB�a�! �����!��T-��F�R`B���F�R`B����a���!�!�������T���H�R`B��@B�R`B��a���!�!������Ta���! "����롹�T��a���!�#������T�?�R`B���a���!`"�����`�Ta���!�"������Ta���!�"�����@�Ta���! #������Ta���!`#����롴�T�a���!'�����@Ta���!@'�������T`G�R`B�����D�RaB�a�! "�����A��T���AG�RaB�a�!@'�����A��T�a���!�$������Ta���!�$�����!��T���a���!$�~����Ta���!@$�x��끭�T���a���!`&�q����Ta���!�&�k��� Ta���!�&�e���!��T A�R`B�j��a���!&�\�����T�!A�RaB�a�!�&�T��끋�T�A�R`B��a���!�%�J����T�@�R`B�O��a���!`%�A��롦�Tu�� �{�����S��*�������*`43�R�5�*�SA��@��{è�_�������*�SA��@��{è�_� �{��������c�G�����a@�����)S��F�������������Y����4 �R���D)!*a���!�G��@�"@�c��ҁT�@��{è�_֏� � �C
с��{���!�G��S���l@�"@��G���@9q�T���G��GA�@�B���AKT�{@��SA��C
��_�[����#� �R���'���J��*@��q�5T!�*�����#����R��R�R��*@�� *|S��
��*�����`������*@���J�!Q�*�k�T�*���2�`�(��c��k��s���`@9lq�0T\q�1T`��(���`��(�[�u�`
@9��'�v�t�ւ8��b)�@�b����B )�����a@9��b�B�)�?@�����a
@9��b�B*�?�����a@9��b�B`*�?�����a
@9��b�B�*�?}�����a
@9��b�B +�?|�����a@9��b�B�+�?|�����a
@9��b�B�+�?{�����a@9��b�B@,�?{�����a@9b�B�,���?~�����@�R��a@9��b�B-�?|���z�a@9��b�B�-�?{���s�a@9��b�B.�?@���l�`@9�6�b������B�.�d�`�9�b)�u�v�q��'�ւ8�������b�B`/�X�a@9��b�B0�?z���Q�a
@9��b�B`0�?~���J�a�9��b�B 1�?q����C�a@9��b�B�1�?~���<�`@9�6}�b������B2�4�`@9�b)�u�v���'�ւ8�{�b����B�2���(�a@9��b�B�3�?z���!�a@9��b�B4�?{����a@9��b�B�4�?|����a@9b�B5���?����@�R�a@9��b�B�5�?@����`@9�7`��?�`��7�`��;�@�R
��7@�a�c@9! <��/��b)�B��u�cEӵ�'��;@�v�Bxc��;�ւ8�wt�R�E�r�ڀR��yԫr`@9b�B�<�{�zC�|�}�����������a@9��b�B@=�?~�����a@9��b�B>�?@�����a@9b�`�B?��?�?�����a@9��b�B�?�?|�����a@9��b�B`�?}�����a@9b�B���?~���uе���@�R��t@y��a�!����Z�>�*�����~��!�gӟ��~����!�iӛ�t@y��a�!����Z�>�*�����~��!�gӏ��~����!�iӋ�t&@y��a�! ���Z�>�*�����~��!�g���~����!�i�{�`@9lqiTt:@y��Z���>a��*!��p��~����!�g�l��~����!�i�h�`@9lqhTc2@9a��?@�!`�b6@9@6���B \�`@9\q�T�[B��cC��kD��sE�C��`��(�Q���!`��t*@y���[B�9��`��(�G�u��c*@9`�b.@9a�!�5��?�@6�B =�a@9��b�B�6�?@���6�a@9��b�B�7�?���/�a@9��b�B`8�?}���(�a@9��b�B9�?~���!�`@9r
TaF@9x�y���b�B�9�?}�������aF@9��b�B :�?~���
�aF@9��b�B�:�?����b"@y�/� �;�a�!�;�B4L�bxb������cZ@9��b^@9a�!��B ���`@9lqi�Tu>@y`�s��`���Z�>�*���U�4�7@�w�v���/��b�����Rz��*�����b@y��B�ZY<�*���aF@x@��!$HӁza����`t�R�E�r!��`C�!�g�����ڀR`ԫr!�����!�i�����k���Tk���7@�a�c@�!���/�B��c|S�;@�Bxc��;����S��`��7�`��;�����[��c��k��s���D� �_��̌R�̬r|!�B�b�B|�KCA|!�K!�b�!|�K!AK*�_� �lSdq�KB|@�e	�R`�@z!!%� X�!�A�!�9� ���_�X�+T�f��X��K��2�R����&���"H�������@��b|›�
��e��g	�RE���XB�J��ǟF&9B|c�"�e|E���E�����e%9��KB"9�_��������T�f���̛҃K��������#H��2�R�@��g	�R�|Û�
��e��E��� �Rc�J�f&9c|��#˅|E���E����˅%9�BKB"9�_���R�R�*�*&9%9"9�_� ��f�҅2�R�K���@�Ң���
��"H��c��C���d	�R|B�B�J�B���"9B|K�"�|C�c�E�`��� 9�� 9�_�{��b��B�G�����A@��������lT`��G��@�@�B���AT�@��{è�_���������`��G��@�@�B��ҡT�@9���@9`��@9�
��@��{�����n����	��@9`��@9���@9�����\�� � � �{��d���k���@���G��S�@�[��#��*�c���R���s���9+��?����R�@������`��:��;� ��R �R���$����A+@�!A+������*�*���Rq�R �7?q�AzmT@@��	6�#B9������*�*�����R`���7@E)Q@+��5�/B9���|��@9 @��5�*�
5�4�R��@+@�?q�CzQ@+��T�R��R����X��K���;@���@/@��/B9���|����4�@9��`���B�o����@9�o@� @����4���J��5�@9�k�T�@9B�k@T�?@�a��*!���"$��R�?@�a��!`�$�@@�2@�����@9�q��a�!�G���@�"@�c��ҡT�SA��[B��cC��kD��sE��{٨�_�A+@��R!QA+���?@�a��!���#����J����5���?@�a��!���#������ � �{��h���G��S����[������c������k��*��	@��7�	���
�������6����
4�g@���5��R �R���+�$�a*@���!a*� ��g@�`*@��*���*Q`*��R������7`.@��5�+@�4�R���R �R���#�a*@���!a*���g@�`*@��*���*Q`*�$�R����`�7`.@��5���R �R���#�a*@���!a*����g@�`*@��*���*Q`*�D�R������7`.@��5���R �R���#�a*@���!a*����g@�`*@��*���*Q`*�d�R��s���7`.@��4�������K@��:���������5t*@�T4�R`��G��7@�@�B��ҡT�*�SA��[B��cC��kD��{Ǩ�_���f���bK4�R@��:����+@������\����K@��:��������T����K@��:��������a��!��9#�����a��!@��R2#��+@�x����a��R!���*#�����a��R!��##������a��R!���#�z���+�����{�����S������[��*�*����_9@@9_94_Px_9��7�|��Z@$9Eyc*@���cc*�W�`*@�Qa*��4dn@��*�*�����@��lXӟq䗟���73�R�*�SA��[B��@��{Ĩ�_�`*@�`*���<�dn@��*`*@����R�@�Q`*����lXӟq䗟���6s*@�4�R�*�SA��[B��@��{Ĩ�_���a��!��"��*��`���k��� �@��4@����@��$@����8��_� � �{��������<@�@����`B@�@����`&@�@����`n@�@����`r@�@����`J@�@������U�`V@�@�������@��{¨�� �{���������������R�@��{¨�_� �{��������������R�R�"�`���*�*�G�`�����b����Ra
�`:������`>�������`B��������`&�������`V���`�b�?9a����B�G�A@�ab����`n� ��ҽ��`r������@��{¨�_����Ҙ������ � �{��e����G��S��[������c��*�*�k��*�@������{���?9������`�w&��#�y2��#9���@9�#�@4a���!����Қ���
4a���!����Ҕ�� 
4a���!�����s����@
4��A�R�����#���������R����`@9�)�) 5c�b��!��`�c�G����#�c@������R��R�Ro��sE�94y���a�!��5�G��@�Z���#B9�59�G�a�b�A)!`�d@� @�Q���q�T����@�q�T`��G���@�@�B���T���SA��[B��cC��kD��{٨�_�`�e@�c�A)���G�a�!��@�3������$�q���T�cV@���b�@���B`������������1������������@���a�! �������#������������9�@9Z�R�qZzAT�*���������*��� 	���*����������#B9@	4@@9q T�4����R����
�[��)�)����� �@9?�qT@9�4�� �@9?�q$@zAT�
4@9�a
4�� �@9@5�O)�@��*�*�{�**��7�{@����#����sE���5{���#9J���#B9#��{��#�	4 �"����*���sE���5l���sE�Y�5i��@@9�5 ��*�{��\���R�k���Ӏ���@������<8���@���b�B����Z���q`T�{@���Z��������@9 ��4�����R�V���@���b���B��~���sE�C���O)�R�@��*�{�����������Z�� ��*�{��9�����������o�P���9�o@����6��{@��*�*b�@���B �\��S�����R�sE�����s���������@���b�B`�M�����sE���������@���b�B�B���������@���b�B��:�����O)�R�@��*p���{�����S���O�����a���`���!�G�a����b@�����B@�@?�:�������B@�@?�������R�SA��{¨�_� ՠ�@�B@����?q�T?q�T?q`������_�`���@��_�`��� ��_� � �{��b��B�G��S������������a���!�����	��4b@�����@?��*��7��A)���@��
��*�SA��@��{è�_�
���`�����@�� �@�!@����{����@��S�����B@�@?��`�@�sҀ�������SA��{¨�_�?�mT�{����@��S�����B@�@?�����lTb@���B@�a����@?�`R��SA��{¨�_�a�����SA��{¨�_���_� � �{����@�����!@� ?�R��@��{¨�_� �@�B @����@�!(@����@�!,@����@�B0@����D��_� � �{��b�����B�G���`�`�C@�������h���'���A�R�&�1`Ta���!��J&��4 �Ra�!�G��@�"@�c��ҡT�@��{Ĩ�_�a���!@�:&� ��5a���!`�5&����5��a�!��0&�q�������� � �$@� @��_� �$@� @�! @�?qK ���_� �$@� $@�@5"(@� �R�5"�@9�5 �@9q���_� �R�_� � �{��c�����c�G��S�`�4$@��[���u@���Җ@�!��������q�T�Q�b�d�v������b@8����!����a��T��@�R�SA��[B��{è���{�����S�$@�c
@�qmT`@��6�SA��{è�_�t��*a�!����G��[��@���v
@��@�ߒq��R`��ҁ�������!��s@�����q�T�Qv������t� �b@8��������a��T��@�R�SA��[B��{è���{�����S�$@��
@��"@�q�K���qmT�@��7�SA��{è�_�[�u��*��G��*�*a�!���@������Rk�@�`�uҁ�������!�Ҕ@�\��q�T�Qu�s�������@8��������a��T��@�R�SA��[B��{è���{��a��������cj�� �G��t��bB@����d&@�a�E@�!���@�@��|C�B@�c�G�c��˗��`.@�qmT�������@��{¨�& � �{�����[���$@��S��*��b�ò@9a~@�B�#�p����7�Z@ysK�� ��87x7IJ@9�� q�	T�T�q`Tc�c !��q�T�q`�c�� �c#�c��
�Pq Tc�c�"��`q�T�@q`�c��!�c#�c���@�0��`�D�!�@#�?넀8�b�B$����a~@���>���� �qA����SA��[B��{è�_�ö@9b�a~@�B�#���0�����7�Z@y�� �sKA�6ú@9b�a~@�B�#���%��`��7�� �sK���c�c� ���c�c "���c�c�!�����c,�c��R�{���c�G��S���d@�������������q�T�*��`b@�K%�`b@����`��G��H�@�B���T��{@��SA��c,��_�T���{�����[��������S��*������q�T�Qv������t�b@8��������a��T��@�R�SA��[B��{è�� � �{�������������S��*������qMT�Q��t��*�����@Tb@8����RC�Qxq�T�������T��@�R�SA��@��{è�� �{��c���c�G��[��S����*u@���r���q�T�Qv������t�b@8��������a��T��@�R�SA��[B��{è�� � �d������*��G����@�����{��!|@����S�������b�B`��[����c��*{����7sK�� ��q�T�Qx�������sK�� ���T�@8��a~@���g���6�SA��[B��cC��{Ĩ�_�a~@�����B@6�\���� �q�����SA��[B��cC��{Ĩ�_� � ����{������d$@��*b�B���`��@�����q���{���_� �{�����[�$@��R�
@��q�T�S����@��R�6�SA��[B��{è�_��*�*b���B���~@�)�����7�
@�v� ��@�_�q�K��R��DЄb�B�������� ���q���SA��[B��{è�_�{�����S�$@��R�
@��"@��q�K����q�T�[����@� �7�[B��SA��{è�_�*�*b��*B���*�~@������`��7�@��q�� ��K��R��d҄b�B��d����� �q�����SA��[B��{è�_�{����dj���@@��t��$@����f@��[��@�c@��|D��*�S�����G���b��~@�B�������������7a.@��� �?q�T�K�SA��[B��{è�_֢K����������7�� ���� � �{����$@��S����A)�[�@�g@��*c*@���b��~@�B $������@�7b&@��K�� ��*��C`�D@�b�B�����q��a.@��� �?q�T�K�SA��[B��{è�_֢K����N�����7�� ��K��� �,@�qMT���R�_� � �{����,@�\@�����_q�TT@�BKB@����a^@�!� �a^��@��{¨�_� � �{��c����c���$@��S��*c�G��[����#�`@��O���'@�qT,T�
4q�
Tt���%��*@����@9`�&�?q��+@��*����*������a~@���b�B�'�B��qd�@z�Ta�!�G��O@�"@�c��ҡT�SA��[B��cC��#@��{ʨ�_�q�T�B@���dj��@��t���c�#@������b���B�&��|D���G����� ���*@�����v��&����&@�tK�� ��*��C`�D@�b�B������q��'@��Ks� �?q�T[@y7`K��t��B%�����c�b���B@'��������t���%����S@���b����*B (���i���@��7s� ��K����������
� ��7s� �`K����*����d��� �7s� ��K��;�� � �{�����S����*$@��[���$@���c5(@�75�@9�5�@9�5��a�?�a�� �`*@�qmTa.@��4�*����L����7�K�� ��`*@�qmT`.@��4`&@� @�qC4Tb��~@�B�(��������7�� ��K`.@�q�T�*��������`�7�� ��K�SA��[B��@��{Ĩ�_�1!��T`*@���q���T�b��~@�B`(���������7a&@��� ��K# @����{��b���B�G���T@�����D@�����\@�cKc@����b^@�a�!�G�@� �`^��'@��@�"@�c��ҁT�@��{è�_���� �{���*�����S�����@�����t��SA��{¨�_� � ���c,�b��{���B�G��S����[������C@�������@�����Re���v�q�T�*����~"������`��G��H�@�B����T��{@��SA��[B��c,��_ֆ�� �`@��� � �{��a���!�G��S��R"@�������T@�\@�,@�#˃K_q
T�*V���a^@�cV@�!� �#˃Ka^�������,���b^@�a�!�G�@� �`^��@�"@���ҁT�SA��{è�_�V�� �{��a���!�G��S� @�$@����� @����Ҁ@�aV@�a���b:@��
4kk
T`6@��4�@�x��`>@��4�@�2���@���9�q�	T�R��`.@�q�	5`b@��4b.@���`�A�!�(��G�@����@����)�� �`>@�f������`@�!�Rab�a*@�a.�@��� ?�b��*������7cV@����b^@���cKc@���a�K��7@� � �`^���aZ@��_qlTaf@�a�`j@� ?�`��G��@�@�B��ҡT�*�SA��@��{Ĩ�_ւ�������!���A��`^@�`Z�����6`.@���q���4�T���R���a^@�!� �ub@�a^�u���`Z@�"�_q��T�����!���'��`^@�`Z����`@�q�T��Xq�T@��)�|��*@��4�&@�`5@�R�&�`&@�q���T���*��D)@�`*���������*����� � �{��!|@����S����[�������B�B`��c��*?�� �7�K�� ��qmT�QX�������#�Y�9C���/���Ks� ���7��@T�@8�����~@�d�Q�xqi��T"���Ks� ����6�#@��SA��[B��cC��{Ũ�_�#@��~@�����B@6���s� �qs����SA��[B��cC��{Ũ�_� �{�������S��*�����!��[���@� (�����q�T�QV�����t�b@8�������a��T��@�R�SA��[B��{è���{��c�����c�G��[��S��*��u@�@�!�� (�������q�T�QV�����t�b@8��������a��T��@�R�SA��[B��{è�� � ��*��B�B (�8��$@��@9�_�$@� $@�5 (@��5"�@9�5"�@9B5�_� @��x��q�T �@9�_���_� �$@� $@� 5 (@��5 �@9�5"�@9��B5�_� ���_�$@� $@�5 (@��5"�@9�5"�@9B5�_� @��x��q���T �@9�_�$@� $@�5 (@��5"�@9�5"�@9B5�_�"@��RB�x�_�qi��T �@9�_� � �{�����S��� �9����7`@�a@9lX�q�T"E�_q�TT4!����@���`+���a@9@�"�2�Xbxc`� ��_q�T!?|q T!����@��� ,����a@9���@�B��!�� +������A���! 2�R����@�R�SA��{¨1���A�!`,�I��a@9��!����@�"���+����a@9����@���!��@-�������@Ђ��!����������@����!�� 1��������@�B��!���0��������@���!��@0��������@�"��!���/��������@���!���/���������@���!�� /���������@�B��!���.���������@���!���.���������@���!��`.���������@���!��@.���������@���!��.���������@���!���-�z�������@����!���-�s�������@����!��`-�l��~����@����!���
�e��w��`@�lX�qT!?�q��T��@���!���1�W��i����@�"��!��-�P��b����@����!���,�I��[����@���!���,�B��T����@��SA��+��{¨���!��9���@�"��!��`1�3��E�� �b���B�G�@@����{��h������G�����=�����#�=������'�=�+�=�/�=�3�=�7�=�;�=���������#���@��7����/������')aV@��@�`^@�`�!�!@�6��a^@���7!� �a^�a�!�G��7@�"@�c���T�@��{Ҩ�_�?9�������{�����S�`@����R��K���B�*_q�T�*�SA��@��{è�_���}������`^@�`Z��*�SA��@��{è�_�{�����S�\@�����X@��˟q-T�*����f������`^@�`Z��*�SA��@��{è�_�{�����R��&�RE�D�3��4�C�B�c�4�B�4�A�!�4����R�{���_� �{��`���HC��4A��!5������@�a5��R��{���_�{��������H@��[��*�S����@��*�R?q
TD@�?k3Ѓ���*1��J@�D@��@�B�3�!KD����kmT ՂK��3��*��sq
T�k��T�SA��[B��@��{Ĩ�_��&@�q�TA��!5�f����@�A��5��R��SA��[B��@��{Ĩ�_�`�HC����4��{�����S����[���6@�aF@�"�bF�!@9�9?(q�T�����T�J@�b�@�BQb��B��6`@�a�aF��R��`��q�T�J@�`�@�Q`����J@��@�q!T�@9?(q���T�9�SA��[B��{è�_֠&@�q�TA��!5�!�p��@�a5��R��SA��[B��{è�_�`�HC� ��5���
�c��{���c�G��S��[��*���c��c���a@��W����������cA9�g�B�R������QcqIT�q�T'@�qT`�HC��5A�����"@�b5��R"�a�!�G��WA�"@�c��ҡT�{@��SA��[B��cC���
��_���A��! 6���'@�qM��TA��!5�����������k�u����q`T����p�����B�R�ҫ���*q-TW@���@qlT�*�*�� ���'@�q
TA������*!�5��*���������kD�3����X�'@�q�TA��!5������@����5��R���@Q�R����*���R����#K�q�T���*���������*��@�R��?k,��T���R��k�6��`�HC����4�� �{�����S��*�[������������������������*�*����k!T���*���SA��[B��@��{ĨI�����&@�q-TA��!5�T��@��5��R�����*���SA��[B��@��{Ĩ5��`�HC�@��4��{��B��*��B�G��S���H@�A@��G���@������@�
����B�B�6�����*����B�B�6������@�A�!�G��G@�"@�c���T�SA��{ɨ�_���������� � �H@���!@�C�B�c�6�B7������_� � �H@���!@�C�B�c 7�B@7������_� � �{��D����G��S���H@��@�������*"*_<qHT�*q�T��@���7�@��4����R�*����B�B�7�:���*����B�B�7�d����@�A�!�G��@�"@�c���!T�SA��{Ө�_�������@������� �{��B��*��B�G��S���H@�@@��o����<qiTA�!�G��o@�"@�c����T�SA��{Ψ�_�����R����5@�B���B�7����*����B�B8�*����@���R���T���{��B�����B�G��S���H@�A@��G���`������@�
����B�B 8�����*����B�B@8�
����@�|@�A�!�G��G@�"@�c���T�SA��{ɨ�_��������*�� �{��������L@�@�Z��`J@�N���@�a�7�@��5�@��{¨�_���C��@�c`8��{¨B�B�8���{��B��B�G��S���H@�@@��G��ғ�����[�u@�������B�
��B�8�������*��B���B�8���� �7�J@��7����"�@�kLT!�@����kT��f���N����
��[B�@��G��G@�@�B���a
T���SA��{ɨ�_�BQ�7�_q-T��R���*��R!�R����7@����7�J@��@�?k�T�&@���?q�T�@�?k*��T_qMT�R���*��R!�Rp���7@���6 �BQ�7�_q-T�R���*��R!�Rc���7@����7�J@��@�_k��T�&@���?qM��TA�! 9���������N�������A��!�8����J@��7@��@�?k��T����c����[B�����[���� � �{����H@��S����@P@��������bJ@�_P�@T@������bJ@�_T�@X@������bJ@�_X�U@��Ru�7T�@��5�@��*�SA��{è�_��*��C�B�c`9�B�9�.����*aJ@��*?��]��`J@���@���*�SA��{è�_��� � �{��D��*����G��S�����[����*�@��G���
����B�B�9�������*B�B�9�������*|@���������*�*�������@��G��G@�@�B���T���SA��[B��{ɨ�_��� �{�����S�H@�3�b@���?(q�TT?q TS�s�9�?q�Ts�s"
�?qs"�s�����SA��{¨�_�?,q T?0qaTaZ@�!������SA��{¨�_�s�s"
�sb����SA��{¨�_�aV@�a����*"�R�����J@�`V�!T@����aR@�!����*�R�����J@�`R�!P@�����*B�R�����J@�`Z�!X@����������{��B��B�G��S����[���0@��c�w@�A@������u�A)@5�>q��Oz��Gz�TW��aV@���R����*��B��*�*B�;����R��A�!�G���@�"@���ҁ)T�*�SA��[B��cC��{ݨ�_�`J@�`�����A����!��Y���*�5��A�R�����`V@�����C�@����!��c�G��:�c@�������B�B`��#������k���+� ����A�R���`����8y����R!�-��� gE������R����� ��#��������c���B�B@>��� #+���@�`&@�qMT�@�����A��!`>��� #+�@�@��4��7��������@�`:���@� ?����������5�@�8�������`�!�R����*�R���1�T���q�TA
T�s@�7���w@��R���1@T!�R�R���1�T�w@�+������@�k�T�*����*1�T����*���k�T�@��J���*1�T����*���k�T�@�L���*1`T����*1@Tq�T�R]��A�!`<��!�= �<�=Ѐ<H���ҧ��`J������"D��	����
�L�� #+�@��@�����@��:����@�����w@������4���s@���7`J@���b&@�a����C��c�8�c��"H���
��B�B��o��B����*B��������
�7�#���������B�R�����������������B�R���������������B�R�����������������B�R��������*�*�*��`�aJ@� �R�*�kD��+@� ���@��?��� �`V@� �A�!@�� @�!�A�����kD��+@���A�@�!�<�=�4�� g��������!#+� ���A��!�=�f�
��!gE�����������! @y����*����kD��+@������kD��+@����A��! =�P����A��!@?������k��+�]��@� �r������@�@�`�l��*����R���!��@�R���!��`�R���!�Ҁ�R�����R��L����7@�����������C�c�������@���N�����@� �I��*����@�@���C��*�����"�C�{����S�����b�G��[�g@�cA)�c��c	�eB)�#��*Ȁ�@@��O���B���B �����*b@�`b��5��`@�������a@��7y
@�?qmT#qIT�����*�*���k�T4� Հ&@�q�TA��!5�8��@�`5��R���4a@��*�*��kAT�*��B�B������*`
�7b
@��c�����BKb"����B�R������`&���������B�R�������`*���������B�R�������`�9����������B�R�����`R����q�T�RcR��Qb���*���R_����K�qT���*��X���`@��5��*�*�� �����*�*p��k���T�RT�@�HC���4���qT?qa@���?j�T�R@��G��OD�@�B���AT�*�{@��SA��[B��cC��#@���"��_����*��@�R'����k�T����&@�q-TA��!5����@���5��R�����b@��*�*���R�����@�HC�@��4�[���*b���*�������H@�$@�#�@�a�7a@�&��A�R�RA$��_���_�@��
��_�{����@��S����[��*�*�*$��$@��?�`Z)uR)�SA��[B��{è�_������{������S���@@�������>@�a@�@�`@�!��a�@��H��!���� ����!Ѥ��Tc��SA��{¨�_�{���*��������C��@���
�@�f��@9	k���T�@9_k!��T���@��{¨�_�@����A����@�&��@9	k���T�@9_k��T�@�&���qT5q�T�q@T"5�|@��*�q�T��B�B@�������@��{¨�_�G���q�T�
q�>������q�@=��Ѐ����*�|@���B�B�k�������B�B��e�����@��{¨�_�����*�|@���B�B��Y�������*�|@���B�B@�Q������ � ���F�{��C���G��S�i@9�[����*�c��k����@9�s�$c�@��������q	T�*��7@?@9G@9W7@9|S��@;@9��#5L�MЛ�������*c4@@9L�V@9���A@9�R\S�R@*��*��������������� C@�!G�#G@��#��*
�R�?��G��*��V����@����?@�@�I@9���)a~@�?�q T9�&�8�#�8����*��B�B@
��?�����*q�?@�MT@9l	K/}@��}@����5�����@�*�8��*��q@����*�����@�B���B�
����?����[�������@��*�@�q�?@��[@��T�Kx� ��@�DЄ@�E�q@����������@�F�� 	�q�@����G�q�@�����`	�q�*!@������B�B������*q�T9K� ��@�!@��4�q�T�
q�T�q�T�
q�TC#@y��RB���c�ZB�
�c<c|c|S�����79K�� �!@���b�B@6����)Ki	Kq�T@��G��@�@�B����T�	*�{A��SB��[C��cD��kE��sF�����_�L�M������R�R������)������a~@�����R����R���?�q!�TF�9�� �g��@@9A�!�1�V3@�@�G��
�Z�K�F�E��	�;xb�B��@?@9\3@9G@9|S��@;@9��W7@9C�4��q��TE?@9B�C�B�	�c�>�F#@y�z�@�D@�c���}�
���ZE�	�B���<��B@���x�4��q��T �iK�48���E�G����@��	�R�9���iK�9����j/8���iK�78�����b�B@6���)Ki	Kq��T� C@�&�R#G@��*
�R�R�{���X���I@9���{@���C#@yB���B 
�c�Zc<��qL�T��]�� �?q`T?q�T?q`�@����_�`����_�`�@�`��_���_� ��C@��_� � ���H@� C�$�@x`x<q�Tq���_���_�?�q�TqB�OzHTH@��!||�"�"�B�}�C�#��`�y�_���_���_� �_<q䜀R`�Gz �Dz�T`���_�!||�"�"����H@�B�}�C�#�c��`@��_� � �@�?q�T?q�T`�@�?q�����_�@��9��_�`�@�`��_���_��R�_� � �_��R�_� ���_� � ��R�_� � �{��C��c�G��S�@�������*��`@����ҁP���*�7�����7�Rs4q`T
qAT���*�P���7����|A�!�G��@�"@�c����T�SA��@��{Ĩ�_�������{��������L@�@����N��@��{¨�_� �{�����S���$@�����q�T`b@�a���! �W�����|@���#����aJ@�`N��! F� ���SA��@��{è�_�{����.������R�"��{���_�{����%������R��"��{���_� � �{����������R��"��{���_�{����������R�"��{���_� � �{��a�!����T@������{���_�{�����R��&�Re�d�@����c�b�c��B��a�!���
��R�{���_�{��A��!�G��S���@�"@��g��ғ&@���7`@�0q�TA���R���aB�A�!�G��g@�"@�c���aT�SA��{ͨ�_�[��#��R�R���#��������R�R��`@��6A�R��9w
@�`6 �R�w�b@�_q�TB|@�ab���u��a�B)}�R�R�
@�# Q?qc�|c0���e@�ar���/��c��7��{��?9����* �7`@��	6`@��/@�?�@	Tb
@��c@�kb��R��a
@��c@�kiTK`"�&�U�7 ��9�R�[B��@�"����w
@�a�R�q!ԟ��9�����&@�`*�?q�T`@��6`@��/@�?��T&�`*@�Xq`Tdq(T��῿� (���7��[B��@�����7@�@9?@���T�?B9a���@�B bR�C�Rb�R �@9c�9
q���T!�R@�Ra&�`�9��&����7@�@9�4��Rb*��@9���4����b@��*a�!��Z�����[������ �{���a��!@�����{���_�{���a��!�����{���_� � �{��`�@�������R�{���_��*�4!Q?q�TAb��:��R�_���_� �{����H@��S��	�" F��[�������c��k��R�s�@�Q�k�T8@��RC���|� �y�7��RZ�}� Փ@��@� ��y`�7^���J@�S�{�3�{�}� �t
y@�������J@�;���#qa��T��Bq���T" F�9?�q���T@�H��R��x���J@��[B� F��cC��kD��sE������*�SA��{ƨ�_��*�SA��[B��cC��kD��sE��{ƨ�_��� �{����H@��S�A��[����k� �ҙ��c��R�+��@��R����|���"h`xB2"h x��5��RZ�}� Փ~@��@� ��y`�7���J@�S�3�{
y�"q���T��Bq���T�qA��T! F��R �H���/���J@��[B� F��cC��kD��+@������*�SA��{ƨ�_��*�SA��[B��cC��kD��+@��{ƨ�_�����F��{������G��S����[������c��*���k������@���������R~���5�*��@�@qT@��G��A�@�B���!@T�*�{B��SC��[D��cE��kF����_������s�M������ �Ҡ5��@�(@q`T����/���&@�q�TO�#����|М��������`���`�=����C���@��������� ���{#�����Ta��!���
��a�!@��
��a�!��
��a�!���
��sG�����C@�a�!'����@��5��@�s�|�aB��������@�@	4���c�����4;�������T�@9�q�,T�@9��qA,T�
@9'�R�Q	
B�A� ՠ.@��
5 ���R���J@�c�q`2T`|@��!�Ӆ��haxA?<q T�k���T�@9k!��TBD�k���T�|�!�)�!�}�!�<���"�y_1�TC�7y$��*3�R�Ӂ�;9�h 8�)�\��&@�k�T�sG�a��`�B�R��P���@�q'�R��ZB�R`�����G��q�@���ZB�R��`���?��q�@�	��ZB�R��`���7���c����q�����Z%���@��@��@���4aB����������*�@��q��R�@�������b@�����a�!�����G���V@��	*�*�*�*��a�!�!�������r���@��@��@�����*�	*��a��!@"��R
��sG�
������Q��Q?qT� 8��R��y�G9�q�T��*������'�����l���K�����������	���kv8�qaT�K@�h68�K@���R�����9�K@���l��O���K@����C������������������C@�<�������C�������������Oq���ǟ����j�C@�A��T�@�Pq@T�@����R�G���C@9�qATC@9�q�TB@9�5�?qMT��! �?Pq�T@������a��!� ��R���sG����܂��R�@���������@�!!�"����T4�*!�)q�T�K@�����@�q�T�@������?�"8�������b@������*���*�*�	*�*��a�! #�����sG�x���*��a��!��}��sG�p�� �R��@�R�������9�G@�@��C�A����������R�C@���j"8��|���G@� ��G���T��K9���5��R��y���K@�L��`����@�����a��!`��RR��sG�E����n���������K���������R��V���q��T�@9��q���T����*Ap�ҫ���@�5�&@�q
T�K�aРb@�!��������@����*�p��������@�`�6����[@��&@�i|?Sh_S{Sq
�T�@��*�b@��	*�*�*a�! �������z���@��@��@�p���K@���R y���R	�R�R�Rg���s�����*a��!�$����Ra��!&����sG�� � �@�?q�TT4?q�T@�@�`��_�����?Pq�TAH@�! F�&�Q���6�_�@�@����_֣u�R磐Rc�rg=�r�|�R�|#���R�|'��{��@�c�l���cK��e��K��`+�d�������b�B '��|����e������@��{¨�_�@��9��_���_�{��G�����G��S��*�[����*�c������k������@��?������Ap�����5`&@��s�q�T�*���p��
��@�7�g@��7@�a&@�<S\S|S?qMT`b@��*�*�*�*a�!�'�����g@�"����V������sE���@��G��?@�@�B����T�SA��[B��cC��kD��{Ȩ�_��F�a�`b@�!`'�����*���p�������6��*�g����sE���s�����_� ���_� � �{�����������R�"��{���_�?�qHTH@��!|x�"�!����� �Ax�x��6 �TB@�_��T�R�_� �R�_�?�q(TH@���!|x�C� �c�B���Ax�x��6 �TB@�_���T�R�_� �R�_� � �{��B���B�G��S���H@��s���A@������ F��ԉRB�Q�_k,T@��c�Q���4��@��G���@�@�B��� T���SA��sE��{ڨ�_���[�`&@��@��@��H�q-T@�a���!@)��G���@�W��O�C��"����ҁ�R`�*����������`���+���R����K@����k�Z�@�2�y���9�+��c��c��7��#��;��K@����IT�O@���}����3�xu����9���O@��7@�xu�����c9������R�?�%���?@������;@���B�R����!��T�G@���B�R�ғ��� �A��T 
�R9�3@�A�2��O@�hb�����c9�������R�����������B�R��}��Tv��[B��cC��kD�����c��#��2�k��C��R�[����R�Rd@��*�*�*���$@��?�*@�7��AN���������7�@��@�_k�T��"q���T��Bq��TZ_�q���T����MT�C��#��R����R�Rd@��*�*�*���$@��?�*@�7��AN���������7�@��@�_k�	T��"q���T��Bq��TZ_�q���Tw��#���(��R�R ��Rd@��*�*�*���$@��?�`�7��AN�ҥ����7`&@�q-T�@���`b@��*�*�*���������Ӏ���"q���T��Bq��T�ߢqa��T`J@��c�@�]���cC��kD�@�4��`J@��[B�@���7���*���N��|������cC��kD�����\����[B�����*���N��p������[��c��k���� � �{�����R���S�t�����[�v��,�������&�R#�b�c�8�B ,�a�u�!�,�������������R&�Re�c��@�c��b�B�������������R&�Rc�b�c�,�B-����R�SA��[B��{è�_� �?�q�TqB�OzHTH@��!||�"�"�B�}�C�#��`�y�_���_�{����RC�q��|c�G��S���*a@�����������*!@���?���@�7���*�����7�S@�@qTa�R�*�[������R2�*���*����R���R��R�	���R���s�q�T���*�Ҡ��q��T�T���@�?,q$Ez`Jz-��T�*�*��R{���[B�@��G��@�@�B���T�SA��{ը�_�`��-������[��� �{��G����S���H@��[��* F��c��*��G��k��*�s��*�Q��@��W���*����7�@��R��7�@���7�@��:*ZS
�7s��R}�RS�r�R���33����s�f�s~�Ks~9K��)���J@��qHT��3�� F���y1@T��@���??q�T�R@��G��W@�@�B���!T�*�SA��[B��cC��kD��sE��{˨�_ւ F���B  ��k�T�����
TGx�x�*�1��T��%�� F�� ��y���1���T�&@����qT�*��@�??q���T�@�?qH��T%@�$|@���3�b~@��J@���`��y�1ATy��3���|��#A��t� 
�	4?k Wz�Sz�
T����*�R��a�"y�������S������c����s��*����R)�@� *������C��*AP��9����7�J@��2@� F��@���!�4�u�R棐Rb�rf=�r�|	�R�|"���R�|&�a��b@�B�l�BKc�e�dK!`.�C�	��e|&���e��|�K��b���y~���b@��*a��*!/�������R����:@��*���J@�@�a�6�r�����o�����C���o@��4��G��H�����:@��*����J@��b��?�� � ���c,�A��#@��{���!�G��S��[����c�@�$@� @�@T���v@��7`@��:@��k��s�kT�J@�b@�! F�`
@�!�H��*_��T�&@�qlT�* @q,T�������a@�ے�6��*��R���R���J@��c
) F��Q��s�!����T������R���2q�T�q-Tdb�����҂ha8h!8!��k���T`@��7�~@�`@�!�����`Tb
@���`
@��ےb@����*���7k�T�*@��*�*`�@1����J@�a@� F��H�?�@T�R9@����*5���� �7`@��6a@�����`Tb
@����@��)�@�@q�Ta@� �6`
@��K`"��R@9@5�.@�qmT�&@�q
T�R@9a��@)!2��A)�b@�X��b@��R�:@�_k�T��R?q�*��#|!@��c����g�Q���
�7�kD��R�sE�A��#@�!�G�dT@�"@������T��{@��SA��[B��cC��c,��_փ�Rq��!@��|�*c����g�4����6`��-�1�S���J@�#F��H�t��H�?� ��Ta@������ےa�7z��RZ���b@�a�!�/���c
@��* @qM�T��kD��sE���A�ҡ��aB����@�2��[��`Z@y�RbR�a��2`Zy�R�@�`*@���5��R`*����a��Y�!�6���T�.����x@�����B@�`@�q @�MT`�@��T�T �R`&�t����������R �Z��`��-������!@��#�����?��T`�Ҡ��`B�a��@���9���`B�\���:@��� ������&@�����?q�T��`
@���������b@�a�!`0������J@�#F��H���:@���R�*��q!@��c|c����g�������7��kD��sE�_����������R��kD��sE�"�W��`��-�����k��s����{��!��!�G��S�@�#@��G���$@�b�7H@���! F�!��y?q�T������R���RY��@�a
�R�3� 6�
@�@��7��B)���@��R?k}�R!Ѓ��9��9���_@��|`
@������E�c2�P���?����+��)h���a&@��*?qLT��7��A9��9`&@���A9�R�q�T��@ya���@y!`3�`b@�N�����@yq T�T`
4q�T�&��*@�`	4�{@��R�@��"�!�!�G��G@�"@�c���T�SA��{ɨI��q!T@�R�&��*@��A���R���B�!�!�G��G@�"@�c���A
T�SA��{ɨ�_ֆ
@� ��q��Z�7�����*a�`b@�! 3����u��6P��*�dqVz�TaJ@�! F�"��y��7Xq��T���� $����6��@�������� �`B@�@���-T`�R�&���R�*������@y�6�*@�`5��R�*���@9 4��@9�5�R@�A�R��9`5�R�R���@9�5�@�<h�T��9��9�R��&@�@�4�*@��������@�q-T`B@�@���@�R�&��*@���9���`�R���`T �R�&��*@���� �R �#y������@����@��#�����?�L��T�����	����{��!��!�G���"@�����Ҡ���`4�R!�!�G���@�"@�c����T�{ۨ�_�a��s�!4��c���g���q�T�@�q�ן����{��#�_q��c�G��S�P��[��*H��c�������s����72b@��g����*��>����*1aT�k�:�y��3�b���9�4���Z�G�����Rg�����|@��b�sc|�`b�Hy.����*��#���q�A:AT@�@qT��5\@�����qd�� 4����������a�!�4�T�����*�q`
Ez T�kD��3@� ��G��g@�@�B��ҡT�*�SA��[B��cC��sE��{ͨ�_�A�`�!�2��5�����@���8�����w��G�����5���� ��������5��6���`5�����	�R)��������*����,��� ��5@�����������������4 �������kD��3@����k��3�_��� � ��"�{���B�G��s����S�@��[��q�c��[B)@@�������)�����Oz��Gz<T������;���44��@9�4a���! 9�������24a���!`9�����`34�q�T�@9Pq�6T�R�K@���q����*��@9@5�Ra��*!��BxS�R�k��k��)`�@��C��G��k@�q@TqAT�;@�����4x�c6��R��R��@���
���A�R"����* �7�k@�
4a�RS�����Rx�*O�����@��*�*���*���o�����o@��5�
�~Ds_kCT���*���Ҋ�����@��R�je��T�@���A�RB|S�����* ��6�W@������G@�����sx���_k��T�4�W@�@�9�k@��@��k�kM��T�kD��s
jdT#�b��!��`�c�G�@>�c@������R�����K@��R��T�@9�4`��A@��k���`�7a�R�*����x��R�*�����{@�eq`�Q�����x�3�R�6�Z�R����W@����C@�����:����*��������;@�5����*@��5a���!4���������qM��T�@�q�Tx���R�6�v��a���!4����������qM�T�@�q��T`���� 7�)���@�4C�c@�`P@���4$�P��
��!�҄�G�`�`7��@�������RA���"��a���!4������־��qM�T�@�q��T�kD�T��a����! �����* 4���RA�Re����*��6�W@�`���b���B@��R���kD�� ��G��A�@�B���T�*�{@��SA��[B��cC��sE����_ր"@9�5�@9��Qgqh��T���RA�R�4>����*@��7a�Rq����x��R�*l���u��R}�RU�r�������fӵ~K��)�*�*�*�������*�*�*�*�*�����* 
5�'@�qm��Tu���ҵ��x����k��R�K@�6@����*�c@�#���|�#��Rc�y������;��RZ�}� ՁK@�@�3� ��y�1�T�c@��*�*�*������s"qA��T{Cqa��T9?�q���T�kD����z������K�@� F��k�$�?�� F�8A�$F��{��o�*������" ��" �c�����|��� ���&x������R��`�`�`�`�`�`�`�`�t���s�o��T�kD����~��B�B��������B@�@?��*^��4�R\���;@�8����4B�B��������B@�@?��*P���RN��a�Rڽ����Rx�*ֽ�������s��*�������
�����@���S)h���
@9q!�T#�`���`<�c�G�!�Ҕ�7�Rc@������@9>���k�i���������W@���R"�����*�*�*"���B�;�������a���!4������̽��q���T�@�q-��T#��`����c�G��9�!��7�Rc@������@9����Z����*��7a�R������Rx�*�������{��"��B�G��S����[�0@��c���w@�A@�����u�A)�5��q��Oz��Gz�,T`J@��!�����A�!`9�A����*�4@9 5�
1�
B:�T�R�R�k��s�z�y����Z��9����x������*���������R��o����*��������7`&@�q�
T�����������*����� 	4�����A����!������qa&@����?q�#T@9� 5�R ��G��@�@�B���A#T�*�SA��[B��cC��{Ш�_��R�k��s����@��LqHT`&@�a+Ě7�q�SzTq���T�4q�T`b@��*�����o������`&@�q�T`b@�a��*��!��e���`V@�` �a��!�
�C����kD��sE����*���������@��*`b@�����R������`b@���a�!
�L����@���q�T�4�kD��sE����`b@�a��*��!��>������5`&@�q�Tcb@�`����@	�!��м�����x����������R����	�@��Lq���T +Ě@�7��Bq�T�*�����������Rټ���*��7�*������������4���Bq���TY�x�9�6�
�6�R	�@��xq�Mz��T���q`��T�*����ٻ�����R�����*��7��d������6`&@�q�T�*C�����*@������
1�
B:a�T`&@�qM�Tcb@�`����!���R�z���K��6�`��������G�!���@�q���`2@���4�@�b	��!��`���i����@�`����!����c����z����û��`J����� F��o�{� �����������R���'��#��&�#y?��?��#����"�B!�Ӄhaxc2�h!x���������_�q��T�������������*����4����`b@�������������R���R��*��7��������������*��4�M)���w@�7�R���cb@�`����!���������k��s�����W�����`V@���R"����*�*�*b���B���R������kD��sE����`V@��R����b���B@�E����� � � �{�����S������[��*�*�c������#�����a�!��@�������a�!��;�������a�!@�6�������a�!��1�������a�!�,���4��q��'��8������a�!`�"����q�����a��SA�!���[B��cC��#@��{Ũ�� � �@9�qdIz�T@8�qdIz���T�q T�R�q`T@9�5B�R�q�TJ|@����5@8�|@�F�C4exd�Q�Q�h�Qi\Q�cQ�$q�Tc�q�Tdq$���k���Tq���&��_��+�R����R��@9bxB_`q�T��R��@9�R����R��� �{��#�����c�G��C��Rd@����Ҳ���"��@���A�G��@�"@�c���aT�{¨�_�
��� �@9�qdIz�T@8�qdIz���T�q T�R�q`T@9�5B�R�q�TJ|@����5@8�|@�F�C4exd�Q�Q�h�Qi\Q�cQ�$q�Tc�q�Tdq$���k���Tq���&��_��+�R����R��@9bxB_`q�T��R��@9�R����R��� �{�����S�������n���`���A��R#tE�"t�CP�S��SA��{¨�_������{�����S�S��*avE�!� �"�@��*@?�avE�!@�av�A����*����{��$����G��S��*�[��*���c����@��G��������7�k�y��*�R���*������r��*�*��� @z�T �����a��G�!���@�(����@��C��@���@�����kD��5 ��G��G@�@�B���T�*�SA��[B��cC��{ɨ�_� ���a�!���G��@�����@��C��@���@��������*��b����B�������*�k������k�H����{��(������G�����=������#�=���'�=�+�=�/�=�3�=�7�=�;�=��������@��7����/�������)��#����� @��* �R`����� ��G��7@�@�B��ҁT�@��{Ө�_�����{��)�����)�G���=����=���C��#�=���*�'�= �R�+�=�/�=�3�=�7�=���
�������$@��/����'��C�������+
)�@��V��� ��G��/@�@�B���aT�{Ѩ�_��� � �{��(������G�����=������#�=���'�=�+�=�/�=�3�=�7�=�;�=��������@��7����/�������)���#����� @��*�R`�%���!�!�G��7@�"@�c��ҁT�@��{Ө�_ֹ����{��)�����)�G���=����=���C��#�=���*�'�=�R�+�=�/�=�3�=�7�=���
�������$@��/����'��C�������+
)�@������!�!�G��/@�"@�c���aT�{Ѩ�_֌����{�����S��*��r��*�R���*}�����k��*�*���@z`���SA��@��{è�_�{������?q-	TC$Q�*�Q8�1 T@�A��T?�qMTb@�cx�c�"|@�E�z�&c@��S�F���c�����������������!��Ts~z�!r�`T� Qb�� � ��8�8�8�8�8�8�8eK�8�+���T�|S?q�p��Z��t}ӆ��s��qmT�|@�a��s�����@��{¨�_������@��{¨�_�"|@��*������@��{¨�_� � �{��������@���@���Ra@9 �@h`x�7?|q$CzaTa@8���?�q���@��{¨�_��
�$��{�����G��S���[����#��k����*�s�`@��@��W����4�@��G@�A�7<�!�}��G�@��@9@4������R
����R�5m�c@��k�Te(@9�kA��T�|ql
Ta@y!!< @8ay���5�@9�4�Q����c�7�8P �������K@����*���������@9�qd@z`T?q�@����R�@8�qd@zT�q�� j ��T�G@�c�7�<��}��G��@��@8�qd@za��T �E4��q���4�@��G@���7<�!�}��G�@��@9z��5�cC��4�;@����@�%�RUP!�E�@���T,@9?�q�T@�"���?�q$@z���T#xd$q�	T�y@�A@�!A����T �R�q,Tc�<��!�R�y`(9j,9����!�!�G��WA�"@�c���T�{@��SA��[B��kD��sE���
��_ֳ@9`�QqAz��T�*������`����5���@���T(@9ka��T�q�T�,9�@9���# ��q��T�K@��!�@�T��j _q�T�<��* �}��G��
*�@�����0q T?Dq�T�Lq@T�q�TA@9@y!A9����7@��*D�#��
*�@�v��# ��q��T�7@��!���A@��y!�A����A@y@y!Ay����@9����R��5 �R����Q������;�o���
@9��?�q$@z�T!
�R���,9:��#x0q�T�@9cxc0q�T�*�
�!
�R�,9,�����,9(���c����{��%�����G��S���@��@������G�q�
T�[������c��*�@��k��s�;�a���;�x@�@9?�q�T?�q�?T�������?5�[B� �R�cC��kD��sE�!�!�G��@�"@�c����DT�SA��{Ш�_�@9��4?�q�3T�G@��������@���8�R`��������@���`@��c����4��@��o@���7<�!�}��o�@�R�@9���{�����Q�q�@9Az��g�A5�g@�q�@���R?j ;T`@��C����*��`�{���1:Tq!4T Հ@��@�Q��s"���q��T�[B��cC��kD��sE��R���?pq�T�;@��k������k@���@9�q�T�q�!T�@���!4?�q�T�T?�qT)T?�q��T@9@5�@�qm4T�@�Q8@���  ����@9�q���W4X��@9�q@z��T��@� �� ��[B��cC��kD��sE�x��A��4?�q��T@9@5�@�qM0T�@�Q8@���  ��������^���@9�5�@9�[@�x?0q�$T�@9x?0qA'TW4C��@9����?�q�T?�q��T@9�5w��4@9@9���@9��@9k�T@9�@9�5?�q$@z�+T���q���$T�@�b4��{@���?�q���
�*f4?�q$@zT�*�@9�q��@����R�s@�?�q��$@z@T�*�@9�q��`j�T�o@�&�7�<��}��o��@�?�q$@z��!��T �G4�����?�qa�T@9q�\��
T��_8�q`
T�@9x?0q�T�@9x?0q�T��4@@����@��@9t���@9�� �Q?qAz�g@����g��5�@9����" ���_q,�T�s@��!�	��� ?q�T�<��*�}��o��	*�@���@9��@5�@�q�T�@�Q8@���  ����@9���q@z�T��4��@��o@�!
�7<�!�}��o�@����7�@?�1��T�7@��@9��@9?�q$@z`T�q��@����R�s@��@8?�q$@z�T?�q��`j ��T�o@���7 <��}��o�:@��@8?�q$@za��TG4����@��������@9���5�@���5@9?�q@z �T�@9?�q!�T@�R\����@��o@��7<�!�}��o��@9��@����� q�
T%<��*��}��o��*:@���' ����q���T�s@��!����Q���q(T!��  ���AT�aT�Tw�4@@�@���E�&��*�	*�@�@��@9�5Q���4s"� �R�cC��kD��sE����[B�J���G@�����@���`���@9���@���
4 �R�*��T��Q���q(T!��  ���!T�!T�T��4C�����4@@��@��@9�������4C����@9����@9���[B��cC��kD��sE���% ����q��T�s@��!����!�&��*�*:@�k���G@���������@����R`��������@������4@@y@y�@9��s��W4C9�@9��n�����4Cy�����[B��cC��kD��sE�����4@@9@9�7�4 �R@��@9�q@z`�T[����w�5T�������5Q����T���[��c��k��s������{��)�����)�G���=����=���C��#�=�'�=�+�=�/�=�3�=�7�=��#�R������%@��/����'��C�������+
)�@������!�!�G��/@�"@�c���aT�{Ѩ�_�c��� � �{��(����G��S����[����������'�=�����+�=�C�����/�=�3�=�7�=�;�=�?�=�C�=������@��G����?������)�@��@��Q��c ����@���������#�R`�M���q ��T!�!�G��G@�"@�c���T�SA��[B��@��{Ԩ�_�"��� �EХ���{���R���@��C���4����{è�_� �{��������@��{���_� � �����_q-T�T_�q-T`�@�T@|@�F�z���g��F����@���������\�����]�����]�����^�����^�����_�����_�������T}z�c� �_r�
T&4�|@���dhb8h"8B�_��T��_�E|@� �c�_�q
T�?@�T��F�F��a�_�����Qa_���a�^����a^���a�]����a]���a�\����a\����q��T_r�
T�4�Q%������ahb8�h"8B�_��T�_�B|@���`hd8 h$8�����T ��_�BQ%������ �bhd8h$8�џ��T�_���G Q������_8��8��_8��8��_8��8��_8��8��_8��8��_8��8��_8��8��_8��8�K?+��T�|S_q!�p�ׂZ���!t}���ԁ�c�������*�� �G Q����I�� Հ@9� ��9� ���_8��8��_8��8��_8��8��_8��8��_8��8��_8��8K��_8��8?+���T�|S_q�p�׆Z��t}�����c� �k���*��� ���{�����S������[����� �`@���`���5s@�S����R�SA��[B��{è�_�c@�C��������[B���a@��SA��{è��R�_� � �{��"���S���SxE��[���V����	����������� 5s@�s������������`��4�SA��[B��{è�_�A�!@����@�R�����h�������@�R����!`'�B���*������ �{�����S�3�b�+���A@���@ �T�?�$B�`T������@���K������qLTs�+���s������SA��@��{è*��s�+�|@�����`������SA��@��{è�_� �K��_� � ��E��_� � ��E��_� �{�����S�3�a�+���"�� ,@����B�@T����������qhTs�+�a����a.������SA��@��{è���s�+�|@�Q���`.������SA��@��{è�_� � �!�!�+� ,@�@��_� @�!�!��� ���_� �{�������* �����@�3��@��{¨�_� ����$@�aT4hb8#hb8B�k`��T�R�_� �R�_� �{�����S������[���VQ(q�Tq
T`8��Q����K��69�T�SA��[B��{è�_�(q�T��C������6�9`K�SA��[B��{è�_� � �#��*��c�G�`@��� � �{��#���c�G�������d@����������)���4�#@����6�R�����*��7�'@���B2H�!�!�G��@�"@�c���T�@��{è�_�������� � �{�����S���S|@�����)��7����!����W�������ij���5�*�SA��@��{è�_������7�� �������*�SA��@��{è�_���������������*�*�SA��@��{è�_� �{������������!�!HF�?k
T�R"�|!�B(C�A�@h`��S��T
"@�_��T!@������R�@��{¨�_� @��@��{¨�_����@��{¨�{�����[�6���S��c��#�`����JF�k�Ts*k��T7��R"�B`-��*C�a~9��T�����������JF��RaKP9�!!pS/����*����J��SA��[B��cC��#@��{Ũ�����H���a���R!pS�������B�R�������� �R�SA��[B��cC��#@��{Ũ�_� � �{�����S����[��*"���!��* HF�k�T ��R(C��~!����ht�c�C@��`TB@���������������@�@��� �S�U��SA��[B��{è�_�������� �{�����S��*��k���*���SA��{¨�� � ��G�@�����{�����S�S|@����[��*��,����*)���q!T�*���������*�����*���7�*�SA��[B��@��{Ĩ�_�{�����S����*�[��*�c�����Rq
T�*�#��Rx~@������*)����*q�T���qT�#@��*�SA��[B��cC��{Ũ�_��*~�����TsK9�� �q��T�*�#@�� � � �{�����S������[�5жB1������?�R�����
������@�"|@� hv8!�Ӄhcx#h6?� ��T hv8"|@�!�Ӄhcx#�o7�q@z��Tc���`hb8�*5B|@�?q��T@hv8�*B�Ӂhax!h6_q��T@hv8�*B�Ӂhax!�o7�q��Tb�q���TB|@�@|@�Chv8B�aӁhax!h6_q���TChv8@|@�B�aӁhax!�o7#4Qq@��T���hexs�!�B�_q@��TChv8e���5�B1�����!���T!��!8�SA��[B��{è�_֡hb8B�?k�T_q!��T������SA��[B��{è�_�{�����S�4������B1��A�`�.������R���!�!�2�߱�������Z�B1��@����SA��{è�_� �{���R����3�sB1�aA����������@��{¨�_� � � �(G�@�E���_�{��!���S�4(G�T�����;����������SA��{¨Q�����SA��{¨�_�"���?�@(G�@�@TF����_� � � �@9�5�q`T�T�qAT#@�c2#� �@8#4�q���Ti��T�q�T)T�q�T#@�c2#�C@�c2C�@8#��5B@� �RB_q�T�_��q�T�qATC@�c2C���q�T�qAT#@�c2#�C@�c2C���#@�c2#�C@�c2C���C@�c2C���#@�c2#�C@�c2C����{�������G�����R�{���_�C@�c2C����"@�BxB2"��_� �{����c�G��S��*�[���v@�`�7T87�*��N������SA��[B��{è�_�*�@��!�3��*!xb�����������T�g6�*Ű�����SA��[B��{è�_��2����4������B�R�ғ����?6����{�����S��b/��[��B/���*�c�������C���t��� գzs���s����*`?֟�!��T�SA��[B��cC��{Ĩ�_� �_�_$�{�����{���_�Usage: %s [options] image
Options:
	-help, -h	Print this help
	-version	Print version info and exit
	-i filename	Filename to read ISO-9660 image from
	dev=target	SCSI target to use as CD/DVD-Recorder

If neither -i nor dev= are speficied, <image> is needed.
 RRlen=%d %c%c**BAD SUSP %d %d]**BAD RRVERSION (%d)
=[%x,%x,%d]=%x../mntWarning - mount point requestedkafkaWarning - host_name requestedReserved bit setting in symlinkIncorrect length in symlink component=%sFlag %x != %x[%d %d]
********Directory has unusual size%3d %5x %8d %cFile name length=(%d).             ***** Directory has null extent.***** . not  first entry...            ***** .. not second entry. Improper sorting.****Extent==0, size != 0Flags=(%x) Interleave=(%d) File unit size=(%d) Volume sequence number=(%d) %lx: %shelp,h,version,i*,dev*Bad Option: '%s'
Linux1.1.11isovfy %s (%s)
Bad Argument: '%s'
Only one of -i or dev= allowed
ISO-9660 image not specified
rbCannot open '%s'
Root at extent %lx, %d bytes
No errors foundRead error on old image
Seek error on old image
Short read on old image
. %s%sCannot open SCSI driver.
Cannot get SCSI I/O buffer.
/etc/wodim.confCDR_DEVICE%255s %10s %10s %80sCDR_SPEEDBad default CDR_SPEED setting (%s).
Bad CDR_SPEED environment (%s).
Bad speed (%s) in the config, drive description.
CDR_FIFOSIZEBad CDR_FIFOSIZE environment (%s).
-1Bad fifo size (%s) in the config, device description.
Bad speed default setting (%s).
CDR_MAXFIFOSIZEBad CDR_MAXFIFOSIZE setting (%s).
""-���& ����9��3��?������������-���& ����9��3��?��test unit readyrezero unitrequest_senseinquiryInquiry Data   :read capacityCapacity: %ld Blocks = %ld kBytes = %ld MBytes = %ld prMB
Sectorsize: %ld Bytes
medium load/unloadprevent/allow medium removalstart/stop unitset streamingscsi_set_streaming
set cd speedqic 02write_g0write_g1write_g5seek_g0seek_g1flush cacheread bufferwrite_bufferread subchannelread tocread headerread disk inforead track inforeserve trackreserve_track_rzoneread dvd structuresend dvd structuresend opcclose track/sessionread master cuesend_cue_sheetread buffer capBFree: %ld K BSize: %ld K
blank unitscsi_format: preparingformat unitscsi_format: runningscsi_format: post processing %d
- [unable to fork()]Formating in progress: 0.00 %% done.
Formating in progress: %.2f %% done [%d].                           
Formating in progress: 100.00 %% done.        
SaveSet %s Mode Parametersmode select g0mode select g1Mode Parameters (un-converted)mode sense g0Mode Sense Datamode sense g1Mode Sense Data (converted)Cannot read TOC header
CD-Text len: %d
Cannot read CD-Text header
Cannot read CD-Text
wctbcdtext.datCannot read TOC
TOC data: ENT: B0: B0 start: %ld
B0 lout: %ld
tocheader: Session info too big.
Density: 0x%X
Blocks:  %ld
Blocklen:%ld
Pages: 0x%X capacity_not_setread_g0read_g1Device type    : Version        : %d
Response Format: %d
Capabilities   : AENC TERMIOP RELADR WBUS32 WBUS16 SYNC LINKED CMDQUE SOFTRESET Vendor_info    : '%.8s'
Identification : '%.16s'
Revision       : '%.4s'
Device seems to be: unknownAdaptec 4000/4010/4070Adaptec 4000Adaptec 4010Adaptec 4070Adaptec 5500Adaptec 4520AAdaptec 4525Emulex MD21Emulex MD23Generic NON CCS DiskGeneric CCS DiskSony SMO-C501Emulex MT02Sysgen SC4000Maxtor RXT800SBerthold HR-ScannerMicrotek MS300AGeneric CD-ROMGeneric mmc CD-ROMGeneric mmc CD-RGeneric mmc CD-RWGeneric mmc2 DVD-ROMGeneric mmc2 DVD-R/DVD-RWPhilips old CDD-521Philips CDD-521Philips CDD-522Kodak PCD-600Philips CDD-2000Philips CDD-2600Yamaha CDR-100Yamaha CDR-400Plasmon RF-4100Sony CDU-924SRicoh RO-1060CRicoh RO-1420CTeac CD-R50SMatsushita CW-7501Matsushita CW-7502Pioneer DW-S114XPioneer DVD-R S101Missing Entry for dev %dcaddythisCannot load media with %s drive!
Try to load media by hand.
CD capabilitieserror: %d scb.chk: %d sense_count: %d sense.code: 0x%x
Inquiry Data   : ADAPTEC ACB-5500        FAKEADAPTEC ACB-40X0        FAKEADAPTEC ACB-4000        FAKEADAPTEC ACB-4010        FAKEADAPTEC ACB-4070        FAKEEMULEXMD23ADAPTECACB-4525SONYSMO-C501SYSGEN  SC4000          FAKEEMULEX  MT02            FAKERXT-800SACERCR-4020CCREATIVECDR2000GRUNDIGCDR100IPWJVCXR-W2001XR-W2010R2626MITSBISHMITSUMIOPTIMACD-R 650PHILIPSIMSKODAKHPCDD521/00CDD521/02CDD521CDD522PCD225KHSW/OBCDR-240CDD20CDD26C4324/C4325CD-Writer 6020PINNACLERCD-1000RCD5020RCD5040RCD 4X4PIONEERCD-WO DW-S114XCD-WO DR-R504XDVD-R DVR-S101PLASMONRF4100CDR4220PLEXTORCD-R   PX-R24CSRICOHRO-1420CRO1060CSAFCD-R2004CD-R2006 CD-R2006PLUSCD-RW226CD-R4012SANYOCD-WO CRD-R24SCD-R   CDU92CD-R   CDU94TEACCD-R50SCD-R55STRAXDATATraxdataCDR4120T.YUDENCD-WO EW-50WPICDR-632PYAMAHACDR10CDR200CDR400MATSHITACD-R   CW-7501CD-R   CW-7502CDS615EBERTHOLDnot 
Drive capabilities, per MMC-3 MMC-2 MMC page 2A:
read CD-R media  Does %s%s
write CD-R mediaread CD-RW mediawrite CD-RW mediaread DVD-ROM mediaread DVD-R mediawrite DVD-R mediaread DVD-RAM mediawrite DVD-RAM mediasupport test writingread Mode 2 Form 1 blocksread Mode 2 Form 2 blocksread digital audio blocksrestart non-streamed digital audio reads accuratelysupport Buffer-Underrun-Free recordingread multi-session CDsread fixed-packet CD media using Method 2read CD bar coderead R-W subcode informationreturn R-W subcode de-interleaved and error-correctedread raw P-W subcode data from lead inreturn CD media catalog numberreturn CD ISRC informationsupport C2 error pointersdeliver composite A/V dataplay audio CDsNumber of volume control levels  %s: %d
support individual volume control setting for each channelsupport independent mute setting for each channelsupport digital output on port 1support digital output on port 2send digital data LSB-firstset LRCK high for left-channel datahave valid data on falling edge of clockLength of data in BCLKs  %s: %s
Loading mechanism typesupport ejection of CD via START/STOP commandlock media on power up via prevent jumperallow media to be locked in the drive via PREVENT/ALLOW commandcurrently in a media-locked state  Is %s%s
support changing side of diskhave load-empty-slot-in-changer featuresupport Individual Disk Present featureMaximum read  speed  %s: %5d kB/s (CD %3ux, DVD %2ux)
Current read  speedMaximum write speedCurrent write speedRotational control selectedBuffer size in KBCopy management revision supported  Number of supported write speeds: %d
  Write speed # %d: %5d kB/s %sCLV/PCAVCAVreserved(2)reserved(3)traypop-updisc changercartridge changerreserved(6)reserved(7)32162424 (I2S)d`\XTP����LHD@<8����40��������,���������(���������$ �������������������������������������������������������������������������������������������������������������������������������������������������Mb�?  ATIP start of lead in:  %ld (%02d:%02d/%02d)
  ATIP start of lead out: %ld (%02d:%02d/%02d)
Warning: controller creates hard SCSI failure when retrieving %s page.
Mode Page  DataWarning: controller returns zero sized %s page.
Warning: controller returns wrong size for %s page.
Warning: controller returns wrong page %X for %s page (%X).
Warning: controller does not support %s page.
Cannot get %s data.
Cannot get %s mask.
Cannot get default %s data.
Cannot get saved %s data.
Warning: using default %s data.
Mode Select DataNo memory for SCSI structureHELPhelpREMOTEInvalid lun specifier '%s'Invalid bus or target specifier in '%s'Invalid target or lun specifier in '%s'Invalid lun specifier in '%s'Invalid value for bus, target or lun (%d,%d,%d)scsidev: '%s'
devname: '%s'
scsibus: %d target: %d lun: %d
usal__open(%s) %d,%d,%d
%sWARNING: device not valid, trying to use default target...
Supported SCSI transports for this platform:yesYYESCDB:  %02XSending %d (0x%X) bytes of data.
Write Data: Got %d (0x%X), expecting %d (0x%X) bytes of data.
Received Data: cmd finished after %ld.%03lds timeout %ds
GOOD STATUSCHECK CONDITIONCONDITION MET/GOODBUSYINTERMEDIATE GOOD STATUSINTERMEDIATE CONDITION MET/GOODRESERVATION CONFLICTReserved host adapter detected errorstatus: 0x%x (%s%s)

Executing '%s' command on Bus %d Target %d, Lun %d timeout %ds
no errorretryable errorfatal errorSCSI command name not set by callercmd timeout after %ld.%03ld (%d) serror: %dErrno: %d (%s), %s scsi sendcmd: %s
Sense Bytes:DMA overrun, resid: %d
Currently running '%s' command.
SCSI ALREADY RUNNING !!Cannot send SCSI cmd via ioctl
ret < 0 errno: %d ux_errno: %d error: %d
Removable not present reserved unsupported
unsupported vendor specific %d TapePrinterProcessorWORMScannerOptical StorageJuke BoxCommunicationIT8 1IT8 2Storage arrayEnclosure servicesSimple direct accessOptical card r/wBridging expanderObject based storageAutomation/Drive InterfaceWell known lununknown/no deviceunit not presentunknown device type 0x%x2���+����xqjc\UNG@9�REMOTE:rscsi@host:1,2,0rscsi@host:bus,target,lunREMOTE:Remote SCSIRSCSILost connection to remote host ??
Remote status(%s): %d '%s'.
Protocol error (got %s).
R%d
resetA
isatapiI
initiator idT%d
%d
%d
%d
filenoB%d
%d
havebusD%ld
maxdmaF
freebufM%ld
getbufsndsize: %d
rcvsize: %d
C
closeV%d
versionforked version from cdrkit/usr/sbin/netscsidrshWarning: Using remote SCSI interface.
Illegal value for busno, target or lun '%d,%d,%d'Illegal remote device syntaxtcpshellshell/tcp: unknown service
who are you? No passwd entry found.
%.*slocuser: '%s' rscsiuser: '%s' host: '%s'
RSHUnknown user: %s
Cannot create socketpair.
dup2 failed.
setuid(%lld) failed.
seteuid(%lld) failed.
rcmdsh: fork to lose parent failed.
-lexeclp '%s' failed.
Cannot get connection to remote hostO%s
openS%d
%d
%d
%d
%d
sendcmddiagnostic failure on component 0x%Xtagged overlapped commands, queue tag is 0x%Xdecompression exception short algorithm id of 0x%Xinvalid sense code 0x%Xvendor unique sense code 0x%X[]no sense, deferred error() [No matching qualifier](valid) (not valid) file mark detected end of medium illegal block length data(valid)(not valid)%sSense Key: 0x%X %s%s, Segment %d
Sense Code: 0x%02X Qual 0x%02X %s%s%s%s Fru 0x%X
Sense flags: Blk %d %s%s%s%serror refers to %s part, bit ptr %d %s field ptr %dactual retry count %doperation %d%% doneNo Additional SenseRecovered ErrorNot ReadyMedium ErrorHardware ErrorIllegal RequestUnit AttentionData ProtectBlank CheckVendor UniqueCopy AbortedAborted CommandEqualVolume OverflowMiscompareno write currentexcessive write errorslogical unit is in process of becoming readylogical unit not ready, initializing cmd. requiredlogical unit not ready, manual intervention requiredlogical unit not ready, format in progresslogical unit not ready, rebuild in progresslogical unit not ready, recalculation in progresslogical unit not ready, operation in progresslogical unit not ready, long write in progress	logical unit not ready, self-test in progress
asymmetric access code 3 (00-232) [proposed]asymmetric access code 1 (00-232) [proposed]asymmetric access code 2 (00-232) [proposed]auxiliary memory code 2 (99-148) [proposed]logical unit communication time-outlogical unit communication parity errorlogical unit communication crc error (ultra-dma/32)unreachable copy target	tracking servo failure	focus servo failure	spindle servo failure	head select faultwarning - specified temperature exceededwarning - enclosure degradedwrite error - recovered with auto reallocationwrite error - auto reallocation failedwrite error - recommend reassignmentcompression check miscompare errordata expansion occurred during compressionblock not compressiblewrite error - recovery neededwrite error - recovery failed	write error - loss of streaming
write error - padding blocks addedauxiliary memory code 4 (99-148) [proposed]
third party device failure
copy target device not reachable
incorrect copy target device type
copy target device data underrun
copy target device data overrunread retries exhaustederror too long to correctmultiple read errorsunrecovered read error - auto reallocate failedl-ec uncorrectable errorcirc unrecovered errordata re-synchronization errorincomplete block read	no gap found
miscorrected errorunrecovered read error - recommend reassignmentunrecovered read error - recommend rewrite the data
de-compression crc errorcannot decompress using declared algorithmerror reading upc/ean numbererror reading isrc numberread error - loss of streamingauxiliary memory code 3 (99-148) [proposed]record not foundfilemark or setmark not foundend-of-data not foundblock sequence errorrecord not found - recommend reassignmentrecord not found - data auto-reallocatedmechanical positioning errorpositioning error detected by read of mediumdata sync error - data rewrittendata sync error - recommend rewritedata sync error - data auto-reallocateddata sync error - recommend reassignmentrecovered data with retriesrecovered data with positive head offsetrecovered data with negative head offsetrecovered data with retries and/or circ appliedrecovered data using previous sector idrecovered data without ecc - data auto-reallocatedrecovered data without ecc - recommend reassignmentrecovered data without ecc - recommend rewrite	recovered data without ecc - data rewrittenrecovered data with error corr. & retries appliedrecovered data - data auto-reallocatedrecovered data with circrecovered data with l-ecrecovered data - recommend reassignmentrecovered data - recommend rewriterecovered data with ecc - data rewrittenrecovered data with linkingdefect list not availabledefect list error in primary listdefect list error in grown listprimary defect list not foundgrown defect list not found access controls code 1 (99-314) [proposed] access controls code 2 (99-314) [proposed] access controls code 3 (99-314) [proposed] read type operation while in write capable state write type operation while in read capable state illegal command while in explicit address model illegal command while in implicit address model access controls code 5 (99-245) [proposed] 	access controls code 6 (99-245) [proposed] 
access controls code 7 (99-245) [proposed] access controls code 8 (99-245) [proposed]!invalid element address!invalid address for write$cdb decryption error$invalid cdb field while in explicit block address model$invalid cdb field while in implicit block address model&parameter not supported&parameter value invalid&threshold parameters not supported&invalid release of persistent reservation&data decryption error&too many target descriptors&unsupported target descriptor type code&too many segment descriptors&	unsupported segment descriptor type code&
unexpected inexact segment&inline data length exceeded&invalid operation for copy source or destination&
copy segment granularity violation'hardware write protected'logical unit software write protected'associated write protect'persistent write protect'permanent write protect'conditional write protect(import or export element accessed)power on occurred)scsi bus reset occurred)bus device reset function occurred)device internal reset)transceiver mode changed to single-ended)transceiver mode changed to lvd*mode parameters changed*log parameters changed*reservations preempted*reservations released*registrations preempted*asymmetric access code 6 (00-232) [proposed]*asymmetric access code 7 (00-232) [proposed],too many windows specified,invalid combination of windows specified,current program area is not empty,current program area is empty,illegal power condition request,persistent prevent conflict0cannot read medium - unknown format0cannot read medium - incompatible format0cleaning cartridge installed0cannot write medium - unknown format0cannot write medium - incompatible format0cannot format medium - incompatible medium0cleaning failure0cannot write - application code mismatch0	current session not fixated for append0medium not formatted1format command failed1zoned formatting failed due to spare linking2defect list update failure5unsupported enclosure function5enclosure services unavailable5enclosure services transfer failure5enclosure services transfer refused8esn - power management class event8esn - media class event8esn - device busy class event:medium not present - tray closed:medium not present - tray open:medium not present - loadable:medium not present - medium auxiliary memory accessible;tape position error at beginning-of-medium;tape position error at end-of-medium;tape or electronic vertical forms unit not ready;slew failure;paper jam;failed to sense top-of-form;failed to sense bottom-of-form;reposition error;	read past end of medium;
read past beginning of medium;position past end of medium;position past beginning of medium;
medium destination element full;medium source element empty;end of medium reached;medium magazine not accessible;medium magazine removed;medium magazine inserted;medium magazine locked;medium magazine unlocked;mechanical positioning or changer error>logical unit failure>timeout on logical unit>logical unit failed self-test>logical unit unable to update self-test log?microcode has been changed?changed operating definition?inquiry data has changed?component device attached?device identifier changed?redundancy group created or modified?redundancy group deleted?spare created or modified?	spare deleted?
volume set created or modified?volume set deleted?volume set deassigned?
volume set reassigned?reported luns data has changed?echo buffer overwritten?medium loadable?medium auxiliary memory accessibleGdata phase crc error detectedGscsi parity error detected during st data phaseGinformation unit crc error detectedGasynchronous information protection error detectedPwrite append position errorPposition error related to timingQerase failure - incomplete erase operation detectedSunload tape failureSmedium removal preventedUsystem buffer fullUinsufficient reservation resourcesUinsufficient resourcesUinsufficient registration resourcesUaccess controls code 4 (99-314) [proposed]Uauxiliary memory code 1 (99-148) [proposed]Zoperator medium removal requestZoperator selected write protectZoperator selected write permit[threshold condition met[log counter at maximum[log list codes exhausted\spindles synchronized\spindles not synchronized]media failure prediction threshold exceeded]logical unit failure prediction threshold exceeded]spare area exhaustion prediction threshold exceeded]hardware impending failure general hard drive failure]hardware impending failure drive error rate too high]hardware impending failure data error rate too high]hardware impending failure seek error rate too high]hardware impending failure too many block reassigns]hardware impending failure access times too high]hardware impending failure start unit times too high]hardware impending failure channel parametrics]hardware impending failure controller detected]hardware impending failure throughput performance]hardware impending failure seek time performance]hardware impending failure spin-up retry count]hardware impending failure drive calibration retry count] controller impending failure general hard drive failure]!controller impending failure drive error rate too high]"controller impending failure data error rate too high]#controller impending failure seek error rate too high]$controller impending failure too many block reassigns]%controller impending failure access times too high]&controller impending failure start unit times too high]'controller impending failure channel parametrics](controller impending failure controller detected])controller impending failure throughput performance]*controller impending failure seek time performance]+controller impending failure spin-up retry count],controller impending failure drive calibration retry count]0data channel impending failure general hard drive failure]1data channel impending failure drive error rate too high]2data channel impending failure data error rate too high]3data channel impending failure seek error rate too high]4data channel impending failure too many block reassigns]5data channel impending failure access times too high]6data channel impending failure start unit times too high]7data channel impending failure channel parametrics]8data channel impending failure controller detected]9data channel impending failure throughput performance]:data channel impending failure seek time performance];data channel impending failure spin-up retry count]<data channel impending failure drive calibration retry count]@servo impending failure general hard drive failure]Aservo impending failure drive error rate too high]Bservo impending failure data error rate too high]Cservo impending failure seek error rate too high]Dservo impending failure too many block reassigns]Eservo impending failure access times too high]Fservo impending failure start unit times too high]Gservo impending failure channel parametrics]Hservo impending failure controller detected]Iservo impending failure throughput performance]Jservo impending failure seek time performance]Kservo impending failure spin-up retry count]Lservo impending failure drive calibration retry count]Pspindle impending failure general hard drive failure]Qspindle impending failure drive error rate too high]Rspindle impending failure data error rate too high]Sspindle impending failure seek error rate too high]Tspindle impending failure too many block reassigns]Uspindle impending failure access times too high]Vspindle impending failure start unit times too high]Wspindle impending failure channel parametrics]Xspindle impending failure controller detected]Yspindle impending failure throughput performance]Zspindle impending failure seek time performance][spindle impending failure spin-up retry count]\spindle impending failure drive calibration retry count]`firmware impending failure general hard drive failure]afirmware impending failure drive error rate too high]bfirmware impending failure data error rate too high]cfirmware impending failure seek error rate too high]dfirmware impending failure too many block reassigns]efirmware impending failure access times too high]ffirmware impending failure start unit times too high]gfirmware impending failure channel parametrics]hfirmware impending failure controller detected]ifirmware impending failure throughput performance]jfirmware impending failure seek time performance]kfirmware impending failure spin-up retry count]lfirmware impending failure drive calibration retry count]�failure prediction threshold exceeded (false)^idle condition activated by timer^standby condition activated by timer^idle condition activated by command^standby condition activated by command^Apower state change to active^Bpower state change to idle^Cpower state change to standby^Epower state change to sleep^Gpower state change to device controlaunable to acquire videoaout of focuscpacket does not fit in available spacedinvalid packet sizefautomatic document feeder lift upfdocument jam in automatic document feederfdocument miss feed automatic in document feedergconfiguration of incapable logical units failedgadd logical unit failedgmodification of logical unit failedgexchange of logical unit failedgremove of logical unit failedgattachment of logical unit failedgcreation of logical unit failedgassign failure occurredg	multiply assigned logical unitg
asymmetric access code 4 (00-232) [proposed]gasymmetric access code 5 (00-232) [proposed]imultiple logical unit failuresiparity/data mismatchkredundancy level got betterkredundancy level got worseocopy protection key exchange failure - key not presentocopy protection key exchange failure - key not establishedoread of scrambled sector without authenticationomedia region code is mismatched to logical unit regionodrive region must be permanent/region reset count errorrsession fixation error writing lead-inrsession fixation error writing lead-outrsession fixation error - incomplete track in sessionrempty or partially written reserved trackrno more track reservations allowedspower calibration area almost fullspower calibration area is fullspower calibration area errorsprogram memory area update failuresprogram memory area is fullsrma/pma is almost full
disk not insertedload/unload failurespindle failure
focus failuretracking failurebias magnet failure#illegal function for medium type8recoverable write error9write error recovery failed:defect list update failed=defect list not available�limited laser life�laser focus coil over-current�laser tracking coil over-current�temperature alarmno additional sense informationfilemark detectedend-of-partition/medium detectedsetmark detectedbeginning-of-partition/medium detectedend-of-data detectedi/o process terminatedaudio play operation in progressaudio play operation pausedaudio play operation successfully completedaudio play operation stopped due to errorno current audio status to returnoperation in progresscleaning requestedno index/sector signalno seek completeperipheral device write faultlogical unit not ready, cause not reportablelogical unit does not respond to selectionno reference position foundmultiple peripheral devices selectedlogical unit communication failure	track following error
error log overflowwarningwrite error
error detected by third party temporary initiatorid crc or ecc errorunrecovered read erroraddress mark not found for id fieldaddress mark not found for data fieldrecorded entity not foundrandom positioning errordata synchronization mark errorrecovered data with no error correction appliedrecovered data with error correction applieddefect list errorparameter list length errorsynchronous data transfer errordefect list not foundmiscompare during verify operationrecovered id with ecc correctionpartial defect list transfer invalid command operation code!logical block address out of range"illegal function (use 20 00, 24 00, or 26 00)$invalid field in cdb%logical unit not supported&invalid field in parameter list'write protected(not ready to ready change, medium may have changed)power on, reset, or bus device reset occurred*parameters changed+copy cannot execute since host cannot disconnect,command sequence error-overwrite error on update in place.insufficient time for operation/commands cleared by another initiator0incompatible medium installed1medium format corrupted2no defect spare location available3tape length error4enclosure failure5enclosure services failure6ribbon, ink, or toner failure7rounded parameter8event status notification9saving parameters not supported:medium not present;sequential positioning error=invalid bits in identify message>logical unit has not self-configured yet?target operating conditions have changed@ram failure (should use 40 nn)@diagnostic failure on component nn (80h-ffh)Adata path failure (should use 40 nn)Bpower-on or self-test failure (should use 40 nn)Cmessage errorDinternal target failureEselect or reselect failureFunsuccessful soft resetGscsi parity errorHinitiator detected error message receivedIinvalid message errorJcommand phase errorKdata phase errorLlogical unit failed self-configurationMtagged overlapped commands (nn = queue tag)Noverlapped commands attemptedPwrite append errorQerase failureRcartridge faultSmedia load or eject failedTscsi to host system interface failureUsystem resource failureWunable to recover table-of-contentsXgeneration does not existYupdated block readZoperator request or state change input[log exception\rpl status change]failure prediction threshold exceeded^low power condition on`lamp failureavideo acquisition errorbscan head positioning errorcend of user area encountered on this trackdillegal mode for this trackevoltage faultfautomatic document feeder cover upgconfiguration failurehlogical unit not configuredidata loss on logical unitjinformational, refer to logkstate change has occurredlrebuild failure occurredmrecalculate failure occurredncommand to logical unit failedocopy protection key exchange failure - authentication failurepdecompression exception short algorithm id of nnqdecompression exception long algorithm idrsession fixation errorscd control errorECC error during verifyinterleave errorbad format on driveself test faileddefective track#volume overflow+set limit violation,error counter overflow-initiator detected error.scsi parity error/adapter parity errorobsolete ATAPI driver in cdrkitBADIDusalo_getbuf: %ld bytes
NOT IMPELEMENTED: usalo_initiator_idATAPI:1,2,0bus,target,lunATAPI:ATA Packet specific SCSI transportATAioctl(CDROM_SEND_PACKET) ret: %d
No remote SCSI transport available.
SCSI open usage error.
None.ERROR: with link merging! base %s link %s, result of merging %i
ERROR: with link reading! link %s, result of readlink %i
INFO: %s -> %s
/ERROR: unknown format
EXAMPLE: /dev/scsi/host1/bus2/target3/lun4/cd
EXAMPLE: /dev/ide/host0/bus0/target1/lun0/cd
EXAMPLE: /dev/hda or /dev/sr0
scsiideINFO: l1: 0x%lX l2: 0x%lX
INFO: Bus: %d Target: %d Lun: %d Chan: %d Ino: %d
ERROR: unknow subsystem (%s) in (%s)
INFO: subsystem %s: h %i, b %i, t %i, l %iERROR: this cdrom is already mapped %s(%d,%d,%d)
INFO: /dev/%s, (host%d/bus%d/target%d/lun%d) will be mapped on the schilly bus No %d (%d,%d,%d)
ERROR: in usalo_get_first_free_shillybus(...). Too many CDROMs, more than %iIncrease MAX_SCHILLY_HOSTS in scsi-linux-ata.c and recompile!dev%d.%d.%dl1: 0x%lX l2: 0x%lX
Bus: %d Target: %d Lun: %d Chan: %d Ino: %d
Target (%d,%d,%d): DMA max %d old max: %ld
Looking for data for major:minor: %ld:%ld
/sys/class/scsi_generic/*/device/block*/queue/max_sectors_kb/sys/block/*/device/block*/queue/max_sectors_kb/device/1,2,0Generic transport independent SCSIsgATA:ATA Packet specific SCSI transport using sg interfaceCannot set SG_SET_TIMEOUT.
Linux sg driver version: %d.%d.%d
SCSI Bus: %d (mapped from %d)
DMA addr: 0x%8.8lX size: %d - using copy buffer
Allocated DMA copy buffer, addr: 0x%8.8lX size: %ld
usalo_send(%s) wrote %d bytes (expected %d).
pack_len: %d, reply_len: %d pack_id: %d result: %d sense[0]: %02X
ioctl ret: %d
host_status: %02X driver_status: %02X
%d.%dretrying in 1 second.giving up.Error trying to open %s exclusively (%s)... %s
/proc/mountsWARNING: %s seems to be mounted!
/dev/sg%d/dev/hd%c/dev/scd%d/sys/kernel
Warning, sysfs is not mounted on /sys!
It is recommended to mount sysfs to allow better device configuration
OLDATAPIATAPIWARNING: the ATAPI: method is considered deprecated on modern kernels!
Mapping device specification to ATA: method now.
To force the old ATAPI: method, replace ATAPI: with OLDATAPI:
WARNING: the ATA: method is considered deprecated on modern kernels!
Use --devices to display the native names.
WARNING: the deprecated pseudo SCSI syntax found as device specification.
Support for that may cease in the future versions of wodim. For now,
the device will be mapped to a block device file where possible.
Run "wodim --devices" for details.
/dev/hdCannot open '%s'SCSI unsupported with '%s'Bus: %d cookie: %X
file (%d,%d,%d): %d
Warning: Using ATA Packet interface.
Warning: The related Linux kernel interface code seems to be unmaintained.
Warning: There is absolutely NO DMA, operations thus are slow.
Illegal value for bus, target or lun '%d,%d,%d'/dev/cdroms/cdrom%itry open(%s) return %i, errno %i, cancel
try open(%s) return %i, errno %i
DEVFS not detected, continuing with old dev
errno (EACCESS), you don't have the needed rights for %s
try open(%s) return %i, errno %i, trying next cdrom
try open(%s) return %i errno %i calling sg_mapdev(...)
/dev/sr%i%s is not a cdrom, skipping
INFO: scan_internal(...) failedINFO: do usalo_open openbydev
Transport name:		%s
Transport descr.:	%s
Transp. layer ind.:	%s
Target specifier:	%s
Target example:		%s
SCSI Bus scanning:	%ssupported
Open via UNIX device:	%ssupported
%s: Error %d%s: %s. getarg_bad_formatany_otherCondition not caught: wr+bwbr+ba+aba+b;P	)�2��8�5��h	,6��|	\6���	�6���	�6���	�6���	�7���	�>���
LF����G���<I��\I��$�M����O���P���|P��
Q��0
�Q��h
<R���
S���
|T��(�T��L�U��xlV���LW����W���X��,,Y��T�Y��|pZ���<[���<\���\��@p]��x,^���@^����^���|_��$`��L`��`�`���`a��� b����b��,�c��d�d���|e���f����f��0Lg��X�g���lh���0i����i���j��DLk��t�k����l���Lm���n��8Lo��h\q����r����s�� �t��x�t����u����v��<w��<�x����x����y����z���|��L����|������HL���t���̈�����������̉��0����d��xL����А���L�����8ܓ��h��|L���� ���������<���\�������$����H\����p���������� ���4|���H\���|,����|���$ܽ��d��x����������������������� p��� ���� L��� ���� ���!<��$!���T!���x!����!���!���!,���!<���!��",��"L��("���<"��h"����"����"L���"���,#p��\#����#|���#����#���#���0$<��P$����$����$\��%��@%<��T%���x%����%@���%���&���0&���h&���|&l���&���&��,'���X',���'@���'L���'����'����'��'\��',�0(@�D(�l(���(���(<��(|�)��L)���)���)��*|�D*��X*��l*���*p��*�+��0+��x+���+L��+p�0,����,l����,����-����$-����T-l���|-���-L���-���.���$.���8. ��L.,��`.|��t.����.����.����.����.����.���.���/���</\	��d/�	���/�	���/�	���/�	���/ 
��0l
��$0,
��p0P
���0|
���0�
���0�
���0��d1<���1��X2���|2`���2l���2|��3���,3���@3\��T3� ���3�!��4"��04\#��h4�&���40,��`5�/���5 0���5L2��\6�:���6<A��l7,B���70C���7<C���7�C���7�D��8�D��8�D��<8@E��\8�F���8`G���8H���8�H��$9�I��H9�I��t9\K���9�K���9,P��P:�Y��,;<Z��P;<[���;l[���;�[���;�^���;,_��<�_��D<�`��x<�`���<�`���<�`���<\a���<�a���<�a��$=�a��<=�b��t=�b���=\c���=d���=�d��(>�e��l>\f���>�f���>�f���>g��?�g��\?�i���?�i���?<j���?Pj���?�j��$@�j��<@<l��\@�l���@|m���@zRxl,��<A,�,��0@�,��< T�,��HA ��B�N���x-���-���A ��B�����-��A�C����C����B����C����S����F����^
��A��AN��B��M��������A�������������������������\����C����A�����D@4��lA�F����C����c����D����B����A�������A��A��A��N����A����������������������������������M����A����A����A����H��'���A�B����C����C����C����B��^
���������AX4�:��hAP�
�	D��B��C��[
��������AB��g��B��������AP�������
�	(��;��|A���D��B�w
�����A�(=�� t�0=��\A��<�;D�:�9B�8�7C�6�5V�4P�e
��������AH�4M�R�4W�A�4N�Z�4E�R
�4AP�4C
�AS�D�4A�B
�4AE�4H
�A LA���A0��E�V
���A p�B��hA0��E�R
���A$� C��hA0��E�R
���A �hC���A ��B�J
���A4��C���A ��B�K
���AN
���AF
���A LD��|A ��D��Y����8<�D���A ��B��J
����AJ
����AS
����A\x<E��hA@��B��C��L
������AF�c
�D������AC
�E������AC
�E������AD� �LF��pA ��D��V����(��F���AP�
�	D��E�m
�����A((\G���A0��B��C��]������8T�G���A0��B��B��d
������AK
������A$�dH���A ��D��a
����A ��H���A ��D��`����$�\I���A0��C��C�^�����$�I���A0��C��C�[�����,,8J���A@��B��C��E�a�������4\�J���A0��B��C��[
������AN������0�PK���A@��B��C��E�g
�������A$�L���A0��C��C�X�����4�tL���A@��B��C��E��_
��������A4(�L���A@��B��C��D��b
��������A`tM��4ttM���A@��B��C��D��b
��������A$��M���A0��C�B��Y�����$�PN���A0��C��C�Y�������N��$�N���A0��C��C�^�����,8,O���A@��B��C��E�]�������4h�O���AP�
�	B��C��D��D�a���������8�(P���AP�
�	B��C��E��C��h����������4��P���AP�
�	B��C��D��D�e���������4	`Q���AP�
�	B��C��D��D�m���������0L	R���A@��B��C��E��d��������(�	�R���A0��B��C��`������0�	S���A@��B��C��D��]��������$�	�S���A0��C��C�[�����(
�S���A0��B��C��\������$4
PT���A0��C��C�[�����4\
�T���AP�
�	B��C��E��C�b���������,�
DU���A@��B��C��E�a�������,�
�U���A@��B��C��F�`�������,�
TV���A@��B��C��E�^�������,$�V���A@��B��C��E�`�������,TPW���A@��B��C��E�]�������,��W���A0��B��D��_
������A0�@X��PA`��D�
�	B��D�B
�������A,�\Y���A@��B��D��E�]�������D�Y��Ap��
D��B�
�	C��j�BHl�HY
��������AE�AH4`�[��(A@��B��C��F��p
��������A4��\��A@��B��C��F��m
��������AT�x]��A��*�)D�(�'H�%�&C�#�$U��A��I����A��(�'�&�%�$�#�*�)L����C�%�&A�#�$(
,^��@<
,^���A@��B��C��F��^
��������AL
��������A@�
�^���A@��B��C��F��_
��������AL
��������A$�
�_���A��&�%D�$�#Y
����A`�
�_���A��*�)D�(�'H�%�&G�#�$_��A��I����A��(�'�&�%�$�#�*�)U
��A��AI��A��C�%�&A�#�$P$a��,d$a���A��(�'D�$�#B�&�%]
������A0��a��HA��*�)D�(�'B�&�%C�$~
�������A0��b���B�PD��
��
C��
��
B��
I
�����AD�<d��A��0�/D�.�-B�,�+C�*�)D�(�'B�&�%q
������������A�Dg���B�@B����C����B����D����`����w��N��������A�@��������������������D��B����S
��Ah��A����,�\i���A��(�'D�&�%B�$�#G
������A(��j��,A��(�'D�&�%B�$|
�����A0$�k���A��*�)D�(�'D�&�%C�$u
�������A(X<n���Ap��
D��B�
g
�����A��n����n��0��n���A@��B��C��E�b
�������A0��o���A@��B��C��E�c
�������A0p��D0(`p��lA ��D��m
����BF
����A \�r���A ��C�Q
���B,��u��|A ��C��V
����AC����4�Dv���A0��B��C�f
�����A`
�����A,��w���A ��B��\
����AZ����lx��0,\x��dA��*�)D�(�'C�&�%B�$M
�������A(`�y���A��(�'F�&�%�$f
�����A�<z���h��z���A�B�N�MC�L�KT
����AA�C�DC�E�FE�I�JD�G�Ho
��A��A��A��AC��A��A��A��B�I�JA�G�HA�E�FA�C�D��{��LA��4�3D�2�1B�0�/\�-�.A�+�,A�*C
��A��A�A]�����N������A��2�1�0�/�.�-�,�+�*�4�3�
��A��A�Au
��A��A�A������A�-�.A�+�,A�*0�����\A0��B��B�J
�����AF����� ������A0��E�^
���A��<����	A�B�R�QC�P�OS
����AA�M�Ni�K�LA�I�JA�G�H�
��A��A��A��AD������B�L�K�J�I�H�GB������A��A�N�M�L�K�J�I�H�G���������A�M�NA�K�LA�I�JA�G�H�p����p���8�����4�����8���`0�,����A0��D�P
���AR
���A@,ؗ���A��2�1C�*�)F�0�/�.�-F�,�+�(�'�
������������A`pd���PAp��
D��B�
�	C��C��R�T�a����������Ap���
�	�������
I�W�G�W�<�P���\A@��B��C��C�f
�������A[
�������Ap���(l���<h��� Pd���|A ��B�[��� t����,A ��B�G��� �̞���A ��C�u
���At������A��2�1E�0�/�.�-C�,�+C�*�)c�'�(`��e
����������Ae�(�'J
��BM
��BA
��BP��F�(�'V
��Ad��C�'�(K
��A$4��xA ��B��Z����\8���X(p�����A0��D��B�X
�����A����� ��@A ��C��K����,����xC ��C��P
����AD���� `���,A ��C�F���(l���<h���Pd���d`���x\��� �X����A@��E�\
���A������������8(�H����A0��F��B��Z������4�����A0��B��H
����AF��`��A����4PD����A0��B��L
����AA��e��A���� ���xA ��D�X���,�H����A0��B��C��@
������A,������B� C����C����Z
����A(���tA0��B��D��U������$8\����A0��B�D��[�����(`�xA0��E����W���������� <�$����A@��C��F��B��[
��������AM���������Ĭ��<B��L��D���A0��B��F��E��B����A0������X��B����DHL����A0��B��J��E��B����A0������Z��A����,�ȭ���A0��L��B��R
������A,�D����A0��C��C��_
������A�Ԯ�� ��HA ��D�L���8(���HA���C��
C��C��B�n
���������A0d ���dA@��B��D��C�{
�������A �P���xA0��F�U
���A �����8A ��D��H����4�IJ���B� B����C����B����`
������A<���$,8����A0��D��d
����A(T�����A@��E��C�\
�����AX�4���AP�
�	C��B��F��M�V�D��������AP��������
�	A�M��������(����A0��C��E��V������(<����A0��F����Z������4����H����\����LpԷ��4��@� ���D0�X����A ��B��x
����A�
����C��$���A��$�#E�"m
���A0����tA0��B��B�L
�����AJ�����(P��\A0��B��B�Q�����|���LA��Q���H���@A��N��<�h���A@��B�C��B��c
�������AP
�������A8�,���A0��B��B��j
������AO
������AH8 ���hA�B�V�UD�T�S�R�QC�P�Ok
��������AQ�M�Nc
��Bh��A�M�N<�  ����A@��B��B��D�S
�������AS
�������A,� �����A���E��H�M�I
����AC�� 0��(!L��(4!h���A��&�%D�$�#N�"S�I
����AB�"B�B�",T!���A���E��Q
����AC�M�D�,�!����A���E��H�M�J
����AC�(�!��dA ��B�M
���AE���D�!H��$A���D��H�
�a��J����A�����
��M��B�
�H(",���A0��C��D�T�C����A0�����O�D����A0����,t"����A���E��B��
e
������A8�"P��$A ��B��U
����AJ
����AF
����A��"8���A��:�9D�8�7E�6�5�4�3d
��������Ab�1�2B�0����S�2�1�0N
��A�BN
��A�A\
��A�AB
��A�AK���A�1�2A�0L���B�2�1�0@d#`��PA�B����B����G��������C���
���������A�#l��4�#���,�#���PA0��C��B��K
������A$$���pA ��C��W����4,$����A ��D�P
���Aa
���A[
���ADd$P��@A�B�"�!E� ���D����C���
������������A�$H��L�$����$���4�$���@�$���%���H$%��P8%<��L%8��`%(��t% ���%��(�%���A@��D��B�a
�����A �%���,A ��B�G���$�%���pA0��B��C�U�����&���$A��G��4&���$A��G��T&��$A��G��t&��$A��G���&��$A��G���&��LA��Q��H�&@���A���D��W
����AA��F�
��A�B]
��A�Ag���A��A� '���$A��G��@'���$A��G��`'��� A��F���'���,|�'���LA`��C�
�	C��D��A��B��q��B��A��A��E����A`�
�	����������C��A��A��A��A����A`�
�	��t(��� A`��C�
�	B��B��C��B�g��B��A��A�E����A`�
�	���������C��A��A��A�A����A`�
�	��x�(X���A�B�|�{C�z�yB�x�wC�v�uD�t�s\
����������AC�q�rw
��AU
��AS
��Ah
��Ak
��AG
��Aj
��AK��A�q�rL�� )���b ��G�M���d,)x�dA���D��
E���
�	D��K��`��M����������A���
���
�	������O��B���)t��)l��)h�$A��G���)l�\�)��X�*��A��4�3D�2�1C�*�)Y
������AB�/�0b�+�,F�-�.B��A��A��B�-�.C�+�,C�/�0q��A��D��C�0�/�.�-�,�+F��A��D��A�0�/�.�-�,�+E������A�/�0A�-�.A�+�,(�*��A0��D��C��j�������*��@4�*��LA��*�)H�(�'V�%�&d��I
����AE�%�&@+��hA���C��C��F����
B��y
������������A�\+�dB��C�� �� D�� �� �� �� B�� �� J�� �� A�� �� ���B��N��������A���� �� �� �� �� �� �� �� �� �� �� �� h��A��E�� �� �� �� c
��A��AE
��A��BD����A�� �� A�� �� \,���lA���H��I�A�K����A������F�M����A������]
�AA
�AF�A� p,����A��6�5R
��At�,4���$A���E��B��G����K��CHm��AHM����������A�������������Hk��AHB��AHt-���A�B�`�_C�V�UB�^�]D�\�[�Z�Yp�W�XV��U�X�Wr��`�X�WL��W�X�WA��O
����������Au�W�Xf��H�W�Xf��}�W�XA����-��PA�� �D��D����\��A��a����Z
��������AB��A��e
��A��AV
��A��AY����N����O����\��A��A����O����A��A��4.�	���AP�
�	B��C��C��C�m���������T.�
��h.p��|.h��\A ��T
��A�.����.���$�.���PA ��B��N
����A�.���DA ��B��P/���`A���D��B��
G��D�	�
]��M
��������AN�
�	H��B
�	�
AA�	�
$`/�
���A��&�%E�$h
���A �/����A��"�!j
��A$�/���A��&�%E�$h
���A �/����A��"�!j
��A(�/@��\A0��B��B�Q�����4$0p��hA ��B�I
���AD
���AG��� \0���TA ��B�Q���|�0���|A�B�V�UC�T�SB�R�QD�N�MG�L�Kf�O�Pu��x����������A��T�S�R�Q�P�O�N�M�L�K�V�UY��H�P�OJ��M�P�OM��U�P�O\��A�O�P�1���`	A�� �D��I��C��C��A��M��B��A��A��I����A������������ �E��A��A��A��B��������q
��A��A��A��A)
��A��A��B��Ao
��A��A��A��Aj
��A��A��A��AU��������A��A��A��A�� �1X���A��"�!g
��A02����A��(�'D�&�%C�$�#B�"s
�������A42���,C0��G��T2���A��D��t2���4�2�"���B0��B��C��N
������AI������,�2#���A0��C��C��V
������A0�2�#���A0��B��E�V
�����AH�����(3$��<3$��P3$��0d3$���A0��B��F�S
�����AH������3l$��,$�3�$��,A ��B�G����3�$��<4�3�$���A0��B��C��S
������AK������$4 %��$<4(%���A0��D�]
���A<d4�%���A0��B��C�P
�����AL
�����AJ�����0�4 &���A ��B�X
���AC
���AC���@�4|&���AP�
�	B��E�����b
���������AR���������,58'���A0��B��B��b
������A$L5�'��,A ��B��G����t5�'��,�5�'��pA@��B��C��B�S�������L�5�'���AP�
�	B��C��B��F�M�E��������AP��������
�	K�46h(���A0��B��C��^
������AK������$D6�)��hA0��B��C�S����� l68*��8A ��C�I����6T*��,�6T*��LA ��C��J
����AC�����6p*��$�6�*��lJ��G��<7�+���A0��D��B��L
������AP
������A0L7X,��|A@��B��C��E��S���������7�,�����@�H�P�X������������ �0���������x����������������� �0�@�H�X��� ��,�T�T�T@�UU ��,��U�T@�U U����
�������o��*�

���hy`<=	���o���o�;���o�o9���o�`���Hh� ������������������������������������������������������������������������������������������������1.1.11Cdrkit@(#)scsitransp.c	1.91 04/06/17 Copyright 1988,1995,2000-2004 J. Schillingremote-1.18cdrkit-team�SpH;�I�F�C�D@D�BB�A�A�@�3�3�3�34@4X4x4�4�4�4 5H5`5x5�5�5h����5�����@�p�����@�p�����606P6x60�X������6���0��6�6H�x��6����(�P���������0��6`��������(7@7 �@�`�x������(�8�P�������0�P�x�`7�7�7��������@��7p����7����@�8p������(X��P80h���0`�8����8�8�8��8 9H9h90`���0h��0�9`��9�9���: :8Xx���8X���H:(Hp���`:��:	0	P	x	�	�	�:�	
(
H
`
�
�
�:;�
0Xx�8;`;�;�;��8`���
8
�;P
h
�;�
<0<H<�
�
0h<�<�<X���<�<��0=p�� @h����0Ph���� =H=@Xx�x=��(Hh���� 8Px���=�=>(>`>p>�>�>�>��0X�>?0?H?`?�?�?�?���?�@ @(@@h@H`����@�@�@�@0X�A���(A @A@p��P���0h��H��@x�� `��@x��8x��0 p � � !P!�!�!"8"p"�"�"#H#x#�#�#$@$x$�$�$ %X%�%�%&0&`&�&�&'@'x'�'�' (X(�(�()8)p)�)�) *hAP*x*�*�*�*+8+X+x+�A�A�+�+�A�A�+B,(B8B,@,p,`B�,�,-(-P-p-�-�-�-.8.xB�Bh.�.�B�B�.�.�BC8C`C�.(/h/�/�/�C�CD 0P0�0�0�0(D181`1�1�1�1@D`DxD�D�D�D�D�DE0EHE�12202@2X2p2�2�2�2�2303P3x3scsi-linux-ata.c-1.7cdrkit-teamscsihack.c-1.44scsi-linux-sg.c-1.86�_p[D_�@d�[^�]�p�v _�[�b�^�\�btb�p�^�^]]]�p ]�^P\�^�\�\Pb�p�^�^]]]�p ]�^P\T�0n vp��b�q^�] q\D\�p0]P\#?*&+?file_write_err
Xbad_file_opbad_file_modebad_file/usr/lib/debug/.dwz/aarch64-linux-gnu/genisoimage.debugE�|[�X�@M"�KӂO<F�b5fcd1a665e836798eee444327cab016c9236c.debug��ܽ.shstrtab.interp.note.gnu.build-id.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.got.plt.data.bss.gnu_debugaltlink.gnu_debuglink88TT$&xx 4���o���>�
�
 F�*�*�N���o99�[���o�;�;�j`<`<=tBhyhy�~��y�������:@����������l��$U$UT	�x^x^�7�����������`�`��`�`����������������L	�4

Filemanager

Name Type Size Permission Actions
X11 Folder 0755
411toppm File 65.8 KB 0755
7z File 39 B 0755
7za File 40 B 0755
7zr File 40 B 0755
GET File 15.82 KB 0755
HEAD File 15.82 KB 0755
JxrDecApp File 22.16 KB 0755
JxrEncApp File 23.52 KB 0755
POST File 15.82 KB 0755
R File 8.75 KB 0755
RTIMULibCal File 66.47 KB 0755
RTIMULibDrive11 File 66.25 KB 0755
Rscript File 66.16 KB 0755
X File 274 B 0755
Xorg File 274 B 0755
Xvnc File 1.54 MB 4755
Xvnc-core File 11.77 MB 0755
Xwayland File 2.28 MB 0755
[ File 66.74 KB 0755
aa-enabled File 66.09 KB 0755
aa-exec File 66.28 KB 0755
aa-features-abi File 66.3 KB 0755
aarch64-linux-gnu-addr2line File 67 KB 0755
aarch64-linux-gnu-ar File 67.01 KB 0755
aarch64-linux-gnu-as File 454.76 KB 0755
aarch64-linux-gnu-c++filt File 66.39 KB 0755
aarch64-linux-gnu-cpp File 1.26 MB 0755
aarch64-linux-gnu-cpp-12 File 1.26 MB 0755
aarch64-linux-gnu-dwp File 1.82 MB 0755
aarch64-linux-gnu-elfedit File 66.9 KB 0755
aarch64-linux-gnu-g++ File 1.26 MB 0755
aarch64-linux-gnu-g++-12 File 1.26 MB 0755
aarch64-linux-gnu-gcc File 1.26 MB 0755
aarch64-linux-gnu-gcc-12 File 1.26 MB 0755
aarch64-linux-gnu-gcc-ar File 66.48 KB 0755
aarch64-linux-gnu-gcc-ar-12 File 66.48 KB 0755
aarch64-linux-gnu-gcc-nm File 66.48 KB 0755
aarch64-linux-gnu-gcc-nm-12 File 66.48 KB 0755
aarch64-linux-gnu-gcc-ranlib File 66.48 KB 0755
aarch64-linux-gnu-gcc-ranlib-12 File 66.48 KB 0755
aarch64-linux-gnu-gcov File 708.14 KB 0755
aarch64-linux-gnu-gcov-12 File 708.14 KB 0755
aarch64-linux-gnu-gcov-dump File 579.99 KB 0755
aarch64-linux-gnu-gcov-dump-12 File 579.99 KB 0755
aarch64-linux-gnu-gcov-tool File 580.07 KB 0755
aarch64-linux-gnu-gcov-tool-12 File 580.07 KB 0755
aarch64-linux-gnu-gfortran File 1.26 MB 0755
aarch64-linux-gnu-gfortran-12 File 1.26 MB 0755
aarch64-linux-gnu-gold File 5.26 MB 0755
aarch64-linux-gnu-gp-archive File 195.11 KB 0755
aarch64-linux-gnu-gp-collect-app File 195.16 KB 0755
aarch64-linux-gnu-gp-display-html File 578.29 KB 0755
aarch64-linux-gnu-gp-display-src File 194.71 KB 0755
aarch64-linux-gnu-gp-display-text File 261.28 KB 0755
aarch64-linux-gnu-gprof File 132.18 KB 0755
aarch64-linux-gnu-gprofng File 194.49 KB 0755
aarch64-linux-gnu-ld File 1.63 MB 0755
aarch64-linux-gnu-ld.bfd File 1.63 MB 0755
aarch64-linux-gnu-ld.gold File 5.26 MB 0755
aarch64-linux-gnu-lto-dump File 25.77 MB 0755
aarch64-linux-gnu-lto-dump-12 File 25.77 MB 0755
aarch64-linux-gnu-nm File 67.84 KB 0755
aarch64-linux-gnu-objcopy File 199.55 KB 0755
aarch64-linux-gnu-objdump File 394.5 KB 0755
aarch64-linux-gnu-pkg-config File 67.88 KB 0755
aarch64-linux-gnu-pkgconf File 67.88 KB 0755
aarch64-linux-gnu-python3-config File 3.01 KB 0755
aarch64-linux-gnu-python3.11-config File 3.01 KB 0755
aarch64-linux-gnu-ranlib File 67.01 KB 0755
aarch64-linux-gnu-readelf File 779.36 KB 0755
aarch64-linux-gnu-size File 66.71 KB 0755
aarch64-linux-gnu-strings File 66.84 KB 0755
aarch64-linux-gnu-strip File 199.56 KB 0755
ab File 66.23 KB 0755
aconnect File 66.16 KB 0755
addpart File 66.16 KB 0755
addr2line File 67 KB 0755
agnostics File 66.77 KB 0755
airscan-discover File 195.01 KB 0755
alacarte File 1.01 KB 0755
alsabat File 66.2 KB 0755
alsaloop File 131.09 KB 0755
alsamixer File 132.02 KB 0755
alsatplg File 130.16 KB 0755
alsaucm File 66.6 KB 0755
amidi File 66.16 KB 0755
amixer File 66.22 KB 0755
animate File 66.09 KB 0755
animate-im6 File 66.09 KB 0755
animate-im6.q16 File 66.09 KB 0755
anytopnm File 12.26 KB 0755
apg File 274 B 0755
apgbfm File 22.3 KB 0755
aplay File 130.21 KB 0755
aplaymidi File 66.16 KB 0755
apropos File 67.03 KB 0755
apt File 66.16 KB 0755
apt-cache File 130.3 KB 0755
apt-cdrom File 66.31 KB 0755
apt-config File 66.16 KB 0755
apt-extracttemplates File 66.25 KB 0755
apt-file File 31.04 KB 0755
apt-ftparchive File 258.41 KB 0755
apt-get File 66.24 KB 0755
apt-key File 27.32 KB 0755
apt-listchanges File 11.96 KB 0755
apt-mark File 66.24 KB 0755
apt-sortpkgs File 66.17 KB 0755
ar File 67.01 KB 0755
arch File 66.81 KB 0755
arecord File 130.21 KB 0755
arecordmidi File 66.17 KB 0755
aria_chk File 5.46 MB 0755
aria_dump_log File 5.27 MB 0755
aria_ftdump File 5.27 MB 0755
aria_pack File 5.27 MB 0755
aria_read_log File 5.39 MB 0755
arpaname File 66.08 KB 0755
as File 454.76 KB 0755
asciitopgm File 65.8 KB 0755
aseqdump File 66.16 KB 0755
aseqnet File 66.2 KB 0755
atktopbm File 65.8 KB 0755
attr File 66.08 KB 0755
autotouch File 1.28 KB 0755
avstopam File 65.8 KB 0755
awk File 712.3 KB 0755
axfer File 130.26 KB 0755
b2sum File 66.95 KB 0755
base32 File 66.87 KB 0755
base64 File 66.87 KB 0755
basename File 66.8 KB 0755
basenc File 66.87 KB 0755
bash File 1.28 MB 0755
bashbug File 6.71 KB 0755
bc File 90.59 KB 0755
bdftopcf File 38.27 KB 0755
bdftruncate File 10.09 KB 0755
bioradtopgm File 65.8 KB 0755
bluemoon File 66.16 KB 0755
bluetooth-sendto File 66.16 KB 0755
bluetoothctl File 388.88 KB 0755
bmptopnm File 65.8 KB 0755
bmptoppm File 65.8 KB 0755
breeze-settings5 File 66.08 KB 0755
brushtopbm File 65.8 KB 0755
btattach File 66.16 KB 0755
bthelper File 1.52 KB 0755
btmgmt File 197.55 KB 0755
btmon File 1 MB 0755
btuart File 1010 B 0755
bunzip2 File 66.14 KB 0755
busctl File 130.35 KB 0755
busybox File 834.63 KB 0755
bwrap File 66.23 KB 0755
bzcat File 66.14 KB 0755
bzcmp File 2.17 KB 0755
bzdiff File 2.17 KB 0755
bzegrep File 3.69 KB 0755
bzexe File 4.78 KB 0755
bzfgrep File 3.69 KB 0755
bzgrep File 3.69 KB 0755
bzip2 File 66.14 KB 0755
bzip2recover File 66.08 KB 0755
bzless File 1.27 KB 0755
bzmore File 1.27 KB 0755
c++ File 1.26 MB 0755
c++filt File 66.39 KB 0755
c89 File 428 B 0755
c89-gcc File 428 B 0755
c99 File 454 B 0755
c99-gcc File 454 B 0755
c_rehash File 6.73 KB 0755
cacaclock File 66.53 KB 0755
cacademo File 322.51 KB 0755
cacafire File 66.36 KB 0755
cacaplay File 66.33 KB 0755
cacaserver File 66.43 KB 0755
cacaview File 66.6 KB 0755
cam File 322.25 KB 0755
camera-bug-report File 4.95 KB 0755
cameratopam File 129.88 KB 0755
canberra-gtk-play File 14 KB 0755
cancel File 66.09 KB 0755
cancel-rename File 1.62 KB 0755
captoinfo File 130.2 KB 0755
cat File 66.93 KB 0755
catdoc File 67.67 KB 0755
catman File 66.52 KB 0755
catppt File 67.14 KB 0755
cc File 1.26 MB 0755
cct File 66.27 KB 0755
cd-create-profile File 66.08 KB 0755
cd-fix-profile File 66.08 KB 0755
cd-iccdump File 66.08 KB 0755
cd-it8 File 66.08 KB 0755
cec-compliance File 324.2 KB 0755
cec-ctl File 393.31 KB 0755
cec-follower File 194.76 KB 0755
certbot File 958 B 0755
cgi-fcgi File 65.93 KB 0755
chacl File 66.08 KB 0755
chafa File 194.06 KB 0755
chage File 134.2 KB 2755
chardet File 221 B 0755
chardetect File 221 B 0755
chattr File 66.09 KB 0755
chcon File 67.09 KB 0755
check-language-support File 2.71 KB 0755
checkgid File 66.09 KB 0755
chfn File 68.96 KB 4755
chgrp File 67.01 KB 0755
chmod File 66.95 KB 0755
choom File 66.16 KB 0755
chown File 67.02 KB 0755
chromium File 6.02 KB 0755
chromium-browser File 6.02 KB 0755
chrt File 130.16 KB 0755
chsh File 67.45 KB 4755
chvt File 66.55 KB 0755
cifscreds File 66.41 KB 0755
ciptool File 66.25 KB 0755
cistopbm File 65.8 KB 0755
cjpeg File 66.18 KB 0755
ckbcomp File 147.14 KB 0755
cksum File 131.01 KB 0755
clear File 66.09 KB 0755
clear_console File 66.01 KB 0755
cmp File 66.83 KB 0755
cmuwmtopbm File 65.8 KB 0755
codepage File 66.29 KB 0755
col File 66.16 KB 0755
colcrt File 66.16 KB 0755
colormgr File 66.11 KB 0755
colrm File 66.16 KB 0755
column File 66.16 KB 0755
comm File 66.87 KB 0755
compare File 66.12 KB 0755
compare-im6 File 66.12 KB 0755
compare-im6.q16 File 66.12 KB 0755
compose File 18.06 KB 0755
composite File 66.09 KB 0755
composite-im6 File 66.09 KB 0755
composite-im6.q16 File 66.09 KB 0755
con2fbmap File 65.93 KB 0755
conjure File 66.09 KB 0755
conjure-im6 File 66.09 KB 0755
conjure-im6.q16 File 66.09 KB 0755
convert File 66.09 KB 0755
convert-dtsv0 File 66.18 KB 0755
convert-im6 File 66.09 KB 0755
convert-im6.q16 File 66.09 KB 0755
corelist File 15.01 KB 0755
cp File 195.57 KB 0755
cpan File 8.16 KB 0755
cpan5.36-aarch64-linux-gnu File 8.19 KB 0755
cpio File 198.34 KB 0755
cpp File 1.26 MB 0755
cpp-12 File 1.26 MB 0755
create_xauth File 104 B 0755
crontab File 66.44 KB 2755
cs2cs File 66.2 KB 0755
csplit File 131.1 KB 0755
ctstat File 66.43 KB 0755
cupstestppd File 66.16 KB 0755
curl File 322.16 KB 0755
cut File 66.91 KB 0755
cvlc File 45 B 0755
cvtsudoers File 332.84 KB 0755
cx18-ctl File 66.39 KB 0755
dash File 130.51 KB 0755
date File 131 KB 0755
dbilogstrip File 1.35 KB 0755
dbiprof File 6.06 KB 0755
dbiproxy File 5.27 KB 0755
dbus-cleanup-sockets File 66.08 KB 0755
dbus-daemon File 258.4 KB 0755
dbus-launch File 65.92 KB 0755
dbus-monitor File 66.08 KB 0755
dbus-run-session File 66.08 KB 0755
dbus-send File 66.08 KB 0755
dbus-update-activation-environment File 66.08 KB 0755
dbus-uuidgen File 66.08 KB 0755
dbwrap_tool File 66.3 KB 0755
dc File 50.02 KB 0755
dconf File 66.01 KB 0755
dd File 131.1 KB 0755
ddbugtopbm File 65.8 KB 0755
ddcmon File 12.97 KB 0755
deallocvt File 66.51 KB 0755
deb-systemd-helper File 23.79 KB 0755
deb-systemd-invoke File 6.09 KB 0755
debconf File 2.79 KB 0755
debconf-apt-progress File 11.27 KB 0755
debconf-communicate File 608 B 0755
debconf-copydb File 1.68 KB 0755
debconf-escape File 647 B 0755
debconf-get-selections File 1.72 KB 0755
debconf-getlang File 6.94 KB 0755
debconf-loadtemplate File 933 B 0755
debconf-mergetemplate File 5.09 KB 0755
debconf-set-selections File 2.92 KB 0755
debconf-show File 1.78 KB 0755
debian-reference File 243 B 0755
decode-dimms File 107 KB 0755
decode-edid File 5.47 KB 0755
decode-vaio File 6.38 KB 0755
decode_tm6000 File 66.44 KB 0755
delpart File 66.16 KB 0755
delv File 69.04 KB 0755
derb File 66.65 KB 0755
desktop-file-edit File 92.2 KB 0755
desktop-file-install File 92.2 KB 0755
desktop-file-validate File 76.43 KB 0755
devdump File 199.88 KB 0755
df File 131.73 KB 0755
dh_bash-completion File 4.31 KB 0755
dh_installxmlcatalogs File 9.22 KB 0755
dh_numpy3 File 1.94 KB 0755
dh_perl_dbi File 1.17 KB 0755
dh_perl_openssl File 1.53 KB 0755
diff File 195.42 KB 0755
diff3 File 66.97 KB 0755
dig File 194.58 KB 0755
dillo File 903.02 KB 0755
dillo-install-hyphenation File 5.59 KB 0755
dir File 195.74 KB 0755
dircolors File 66.87 KB 0755
dirmngr File 582.19 KB 0755
dirmngr-client File 130.68 KB 0755
dirname File 66.8 KB 0755
dirsplit File 16.74 KB 0755
display File 66.09 KB 0755
display-im6 File 66.09 KB 0755
display-im6.q16 File 66.09 KB 0755
djpeg File 66.18 KB 0755
dm-tool File 66.09 KB 0755
dmesg File 138.4 KB 0755
dmypy File 234 B 0755
dnsdomainname File 66.01 KB 0755
dnssec-cds File 67.05 KB 0755
dnssec-dsfromkey File 66.16 KB 0755
dnssec-importkey File 66.16 KB 0755
dnssec-keyfromlabel File 66.16 KB 0755
dnssec-keygen File 66.16 KB 0755
dnssec-revoke File 66.16 KB 0755
dnssec-settime File 66.16 KB 0755
dnssec-signzone File 130.2 KB 0755
dnssec-verify File 66.17 KB 0755
dnstap-read File 66.1 KB 0755
docutils File 960 B 0755
domainname File 66.01 KB 0755
dos2unix File 54.09 KB 0755
dpkg File 322.48 KB 0755
dpkg-architecture File 14.85 KB 0755
dpkg-buildapi File 1.79 KB 0755
dpkg-buildflags File 8.14 KB 0755
dpkg-buildpackage File 34.13 KB 0755
dpkg-buildtree File 1.88 KB 0755
dpkg-checkbuilddeps File 7.45 KB 0755
dpkg-deb File 194.47 KB 0755
dpkg-distaddfile File 2.72 KB 0755
dpkg-divert File 194.4 KB 0755
dpkg-genbuildinfo File 18.54 KB 0755
dpkg-genchanges File 17.92 KB 0755
dpkg-gencontrol File 14.24 KB 0755
dpkg-gensymbols File 10.66 KB 0755
dpkg-maintscript-helper File 20.71 KB 0755
dpkg-mergechangelogs File 8.87 KB 0755
dpkg-name File 6.61 KB 0755
dpkg-parsechangelog File 4.83 KB 0755
dpkg-query File 194.4 KB 0755
dpkg-realpath File 4.09 KB 0755
dpkg-scanpackages File 8.45 KB 0755
dpkg-scansources File 9.1 KB 0755
dpkg-shlibdeps File 31.46 KB 0755
dpkg-source File 23.05 KB 0755
dpkg-split File 130.32 KB 0755
dpkg-statoverride File 130.2 KB 0755
dpkg-trigger File 130.33 KB 0755
dpkg-vendor File 3.18 KB 0755
driverless File 66.1 KB 0755
driverless-fax File 537 B 0755
dtc File 199.67 KB 0755
dtdiff File 680 B 0755
dtmerge File 66.41 KB 0755
dtoverlay File 66.9 KB 0755
dtparam File 66.9 KB 0755
du File 195.3 KB 0755
dump_xsettings File 22.27 KB 0755
dumpkeys File 194.99 KB 0755
dumpmscat File 66.08 KB 0755
dvdauthor File 195.59 KB 0755
dvddirdel File 876 B 0755
dvdunauthor File 130.16 KB 0755
dvgrab File 298.1 KB 0755
dvipdf File 1007 B 0755
dwp File 1.82 MB 0755
echo File 66.8 KB 0755
ed File 66.29 KB 0755
edit File 18.06 KB 0755
editor File 324.64 KB 0755
eepdump File 66.41 KB 0755
eepflash.sh File 4.31 KB 0755
eepmake File 66.38 KB 0755
egrep File 41 B 0755
eject File 130.01 KB 0755
elfedit File 66.9 KB 0755
enc2xs File 40.96 KB 0755
encguess File 3 KB 0755
env File 67.38 KB 0755
envsubst File 66.16 KB 0755
eom File 514.16 KB 0755
eps2eps File 639 B 0755
epylint File 219 B 0755
eqn File 265.2 KB 0755
escp2topbm File 65.8 KB 0755
evince File 515.58 KB 0755
evince-previewer File 66.54 KB 0755
evince-thumbnailer File 66.16 KB 0755
ex File 1.65 MB 0755
exifautotran File 1.11 KB 0755
expand File 66.86 KB 0755
expiry File 66.29 KB 2755
expr File 131 KB 0755
eyuvtoppm File 65.8 KB 0755
f2py File 949 B 0755
f2py3 File 957 B 0755
f2py3.11 File 960 B 0755
f77 File 1.26 MB 0755
f95 File 1.26 MB 0755
faad File 67.48 KB 0755
factor File 131.15 KB 0755
faillog File 66.37 KB 0755
faked-sysv File 66.65 KB 0755
faked-tcp File 66.66 KB 0755
fakeroot File 3.9 KB 0755
fakeroot-sysv File 3.9 KB 0755
fakeroot-tcp File 3.9 KB 0755
fallocate File 66.16 KB 0755
false File 66.78 KB 0755
fbcli File 66.16 KB 0755
fbd-theme-validate File 130.16 KB 0755
fbset File 66.09 KB 0755
fbtest File 66.17 KB 0755
fc-cache File 66.47 KB 0755
fc-cat File 66.41 KB 0755
fc-conflist File 66.22 KB 0755
fc-list File 66.28 KB 0755
fc-match File 66.35 KB 0755
fc-pattern File 66.27 KB 0755
fc-query File 66.24 KB 0755
fc-scan File 66.3 KB 0755
fc-validate File 66.29 KB 0755
fcgistarter File 66.09 KB 0755
fdtdump File 66.17 KB 0755
fdtget File 66.17 KB 0755
fdtoverlay File 66.17 KB 0755
fdtput File 66.17 KB 0755
ffmpeg File 322.4 KB 0755
ffplay File 194.39 KB 0755
ffprobe File 198.91 KB 0755
fgconsole File 66.56 KB 0755
fgrep File 41 B 0755
fiascotopnm File 130.65 KB 0755
figlet File 22.91 KB 0755
figlet-toilet File 22.91 KB 0755
filan File 131.85 KB 0755
file File 66.33 KB 0755
file2brl File 66.01 KB 0755
filezilla File 4.19 MB 0755
fincore File 66.2 KB 0755
find File 259.41 KB 0755
findmnt File 131.43 KB 0755
fio File 1.73 MB 0755
fio-btrace2fio File 66.15 KB 0755
fio-dedupe File 66.24 KB 0755
fio-genzipf File 66.2 KB 0755
fio-verify-state File 66.08 KB 0755
fio2gnuplot File 21.73 KB 0755
fio_generate_plots File 4.09 KB 0755
fio_jsonplus_clat2csv File 12.92 KB 0755
firefox File 848 B 0755
fitstopnm File 65.8 KB 0755
flask File 948 B 0755
flock File 66.23 KB 0755
fmt File 66.87 KB 0755
fold File 66.87 KB 0755
fonttosfnt File 34.27 KB 0755
foomatic-rip File 143.14 KB 0755
free File 66.16 KB 0755
fstopgm File 65.8 KB 0755
funzip File 66.34 KB 0755
fuser File 67.6 KB 0755
fusermount File 66.16 KB 4755
fusermount3 File 66.16 KB 4755
fzputtygen File 322.01 KB 0755
fzsftp File 642.46 KB 0755
g++ File 1.26 MB 0755
g++-12 File 1.26 MB 0755
g3topbm File 66.63 KB 0755
galculator File 156.41 KB 0755
galera_new_cluster File 917 B 0755
galera_recovery File 3.29 KB 0755
gamma4scanimage File 66.09 KB 0755
gapplication File 66.16 KB 0755
gatttool File 131.35 KB 0755
gawk File 712.3 KB 0755
gawkbug File 6.55 KB 0755
gcc File 1.26 MB 0755
gcc-12 File 1.26 MB 0755
gcc-ar File 66.48 KB 0755
gcc-ar-12 File 66.48 KB 0755
gcc-nm File 66.48 KB 0755
gcc-nm-12 File 66.48 KB 0755
gcc-ranlib File 66.48 KB 0755
gcc-ranlib-12 File 66.48 KB 0755
gchempaint File 22.34 KB 0755
gchempaint-0.14 File 22.34 KB 0755
gcore File 3.43 KB 0755
gcov File 708.14 KB 0755
gcov-12 File 708.14 KB 0755
gcov-dump File 579.99 KB 0755
gcov-dump-12 File 579.99 KB 0755
gcov-tool File 580.07 KB 0755
gcov-tool-12 File 580.07 KB 0755
gcr-viewer File 66.15 KB 0755
gdb File 10.01 MB 0755
gdb-add-index File 4.52 KB 0755
gdbtui File 126 B 0755
gdbus File 66.16 KB 0755
gdialog File 9.01 KB 0755
gdk-pixbuf-csource File 66.11 KB 0755
gdk-pixbuf-pixdata File 66.09 KB 0755
gdk-pixbuf-thumbnailer File 66.17 KB 0755
gdm-control File 66.08 KB 0755
geany File 66.04 KB 0755
gemtopbm File 65.8 KB 0755
gemtopnm File 65.8 KB 0755
genbrk File 66.55 KB 0755
gencat File 66.48 KB 0755
gencfu File 66.5 KB 0755
gencnval File 66.41 KB 0755
gendict File 66.55 KB 0755
genfio File 8.63 KB 0755
genisoimage File 665.41 KB 0755
genrb File 195.79 KB 0755
geod File 66.1 KB 0755
geoiplookup File 66.09 KB 0755
geoiplookup6 File 66.09 KB 0755
geqn File 265.2 KB 0755
get-edid File 14.16 KB 0755
get_objgraph File 1.61 KB 0755
getcifsacl File 66.09 KB 0755
getconf File 66.25 KB 0755
geteltorito File 6.06 KB 0755
getent File 67.19 KB 0755
getfacl File 66.63 KB 0755
getfattr File 66.53 KB 0755
getkeycodes File 66.51 KB 0755
getopt File 66.16 KB 0755
gettext File 66.16 KB 0755
gettext.sh File 5.07 KB 0755
gfortran File 1.26 MB 0755
gfortran-12 File 1.26 MB 0755
ghb File 7.22 MB 0755
ghostscript File 66.12 KB 0755
gie File 66.2 KB 0755
giftopnm File 65.8 KB 0755
gio File 130.21 KB 0755
gio-querymodules File 66.09 KB 0755
git File 3.58 MB 0755
git-receive-pack File 3.58 MB 0755
git-shell File 2.09 MB 0755
git-upload-archive File 3.58 MB 0755
git-upload-pack File 3.58 MB 0755
gkbd-keyboard-display File 66.07 KB 0755
glib-compile-schemas File 66.31 KB 0755
gmake File 238.46 KB 0755
gnome-control-center File 3.07 MB 0755
gnome-help File 66.01 KB 0755
gnome-keyring File 66.29 KB 0755
gnome-keyring-3 File 66.29 KB 0755
gnome-keyring-daemon File 1.13 MB 0755
gnome-www-browser File 6.02 KB 0755
gnumeric File 66.16 KB 0755
gold File 5.26 MB 0755
gouldtoppm File 65.8 KB 0755
gp-archive File 195.11 KB 0755
gp-collect-app File 195.16 KB 0755
gp-display-html File 578.29 KB 0755
gp-display-src File 194.71 KB 0755
gp-display-text File 261.28 KB 0755
gpasswd File 134.13 KB 4755
gpg File 1.08 MB 0755
gpg-agent File 453.05 KB 0755
gpg-connect-agent File 194.78 KB 0755
gpg-wks-server File 258.84 KB 0755
gpg-zip File 3.43 KB 0755
gpgcompose File 901.96 KB 0755
gpgconf File 198.53 KB 0755
gpgparsemail File 66.16 KB 0755
gpgsm File 583.56 KB 0755
gpgsplit File 130.4 KB 0755
gpgtar File 195.36 KB 0755
gpgv File 514.83 KB 0755
gpic File 260.11 KB 0755
gpiodetect File 66.16 KB 0755
gpiofind File 66.16 KB 0755
gpioget File 66.16 KB 0755
gpioinfo File 66.16 KB 0755
gpiomon File 66.16 KB 0755
gpioset File 66.16 KB 0755
gprof File 132.18 KB 0755
gprofng File 194.49 KB 0755
grdctl File 66.17 KB 0755
grep File 194.22 KB 0755
gresource File 66.09 KB 0755
grim File 30.16 KB 0755
groff File 137.31 KB 0755
grog File 2.71 KB 0755
grops File 201.7 KB 0755
grotty File 137.33 KB 0755
groups File 66.86 KB 0755
gs File 66.12 KB 0755
gsbj File 350 B 0755
gsdj File 352 B 0755
gsdj500 File 352 B 0755
gsettings File 66.09 KB 0755
gslj File 353 B 0755
gslp File 350 B 0755
gsnd File 277 B 0755
gtbl File 194.29 KB 0755
gtf File 66.3 KB 0755
gtk-nop File 66.05 KB 0755
gtk-update-icon-cache File 66.32 KB 0755
gtk4-broadwayd File 195.3 KB 0755
gtk4-builder-tool File 66.91 KB 0755
gtk4-encode-symbolic-svg File 8.27 MB 0755
gtk4-launch File 66.23 KB 0755
gtk4-query-settings File 66.09 KB 0755
gtk4-update-icon-cache File 66.48 KB 0755
gui-pkinst File 66.45 KB 0755
gui-updater File 66.52 KB 0755
gunzip File 2.29 KB 0755
gzexe File 6.3 KB 0755
gzip File 91.55 KB 0755
h2ph File 28.54 KB 0755
h2xs File 59.51 KB 0755
handbrake File 7.22 MB 0755
handbrake-gtk File 7.22 MB 0755
hardlink File 66.23 KB 0755
hciattach File 68.23 KB 0755
hciconfig File 200.13 KB 0755
hcitool File 199.66 KB 0755
hd File 66.17 KB 0755
hdifftopam File 65.8 KB 0755
hdmi-audio-select File 682 B 0755
head File 66.89 KB 0755
helpztags File 2.46 KB 0755
hex2hcd File 66.16 KB 0755
hexdump File 66.17 KB 0755
hipstopgm File 65.8 KB 0755
host File 130.56 KB 0755
hostid File 66.8 KB 0755
hostname File 66.01 KB 0755
hostnamectl File 66.23 KB 0755
hp-align File 9.14 KB 0755
hp-check File 39.2 KB 0755
hp-clean File 7.05 KB 0755
hp-colorcal File 9.08 KB 0755
hp-config_usb_printer File 6.98 KB 0755
hp-doctor File 12.69 KB 0755
hp-firmware File 6.47 KB 0755
hp-info File 6.26 KB 0755
hp-levels File 6.85 KB 0755
hp-logcapture File 12.15 KB 0755
hp-makeuri File 5.6 KB 0755
hp-pkservice File 3.13 KB 0755
hp-plugin File 13.62 KB 0755
hp-probe File 7.98 KB 0755
hp-query File 4.94 KB 0755
hp-scan File 86.9 KB 0755
hp-setup File 37.25 KB 0755
hp-testpage File 5.98 KB 0755
hp-timedate File 3.31 KB 0755
hpcdtoppm File 799 B 0755
htcacheclean File 66.09 KB 0755
htdbm File 66.09 KB 0755
htdigest File 66.09 KB 0755
htop File 325.66 KB 0755
htpasswd File 66.09 KB 0755
httpx File 204 B 0755
iceauth File 66.64 KB 0755
icontopbm File 65.8 KB 0755
iconv File 66.87 KB 0755
icuexportdata File 69.05 KB 0755
icuinfo File 66.4 KB 0755
id File 66.95 KB 0755
identify File 66.1 KB 0755
identify-im6 File 66.1 KB 0755
identify-im6.q16 File 66.1 KB 0755
iecset File 66.16 KB 0755
ilbmtoppm File 65.88 KB 0755
imagetops File 1.21 KB 0755
img2sixel File 22.09 KB 0755
img2txt File 66.77 KB 0755
imgtoppm File 65.8 KB 0755
import File 66.09 KB 0755
import-im6 File 66.09 KB 0755
import-im6.q16 File 66.09 KB 0755
infocmp File 66.16 KB 0755
infotocap File 130.2 KB 0755
infotopam File 65.84 KB 0755
innochecksum File 4.57 MB 0755
innotop File 445.44 KB 0755
install File 195.73 KB 0755
instmodsh File 4.27 KB 0755
invgeod File 66.1 KB 0755
invproj File 66.19 KB 0755
ionice File 66.16 KB 0755
ip File 729.26 KB 0755
ipa_verify File 66.17 KB 0755
ipcmk File 66.23 KB 0755
ipcrm File 66.16 KB 0755
ipcs File 130.16 KB 0755
ippfind File 66.18 KB 0755
ipptool File 130.09 KB 0755
iptables-xml File 132.77 KB 0755
ir-ctl File 66.17 KB 0755
ischroot File 66.18 KB 0755
isodump File 199.88 KB 0755
isoinfo File 342.2 KB 0755
isovfy File 199.84 KB 0755
ispell-wrapper File 7.05 KB 0755
ivtv-ctl File 66.46 KB 0755
jbigtopnm File 76.63 KB 0755
join File 66.95 KB 0755
journalctl File 130.49 KB 0755
jp2a File 70.53 KB 0755
jpeg2ktopam File 264.27 KB 0755
jpegexiforient File 66.09 KB 0755
jpegtopnm File 65.88 KB 0755
jpegtran File 66.11 KB 0755
json_pp File 4.88 KB 0755
jsonpointer File 1.79 KB 0755
jsonschema File 213 B 0755
kactivities-cli File 66.01 KB 0755
kanshi File 66.1 KB 0755
kazam File 6.28 KB 0755
kbd_mode File 66.69 KB 0755
kbdinfo File 66.54 KB 0755
kbookmarkmerger File 66.09 KB 0755
kbuildsycoca5 File 65.93 KB 0755
kbxutil File 194.61 KB 0755
kcookiejar5 File 66.15 KB 0755
kde-geo-uri-handler File 65.93 KB 0755
kdeconnect-app File 66.09 KB 0755
kdeconnect-cli File 66.09 KB 0755
kdeconnect-handler File 66.09 KB 0755
kdeconnect-indicator File 130.16 KB 0755
kdeconnect-settings File 66.09 KB 0755
kdeconnect-sms File 258.28 KB 0755
kded5 File 130.01 KB 0755
kdeinit5 File 66.12 KB 0755
kdeinit5_shutdown File 66.08 KB 0755
kdeinit5_wrapper File 66.08 KB 0755
kdenlive File 9 MB 0755
kdenlive_render File 130.16 KB 0755
kdtc File 5.51 KB 0755
keditbookmarks File 386.16 KB 0755
kernel-install File 12.75 KB 0755
keyctl File 66.22 KB 0755
kglobalaccel5 File 66.09 KB 0755
kiconfinder5 File 66.09 KB 0755
kill File 66.16 KB 0755
killall File 67.81 KB 0755
kmod File 194.28 KB 0755
kmsblank File 66.25 KB 0755
kmsprint File 66.28 KB 0755
kmstest File 259.27 KB 0755
kpackagelauncherqml File 65.93 KB 0755
kpackagetool5 File 130.01 KB 0755
kquitapp5 File 65.93 KB 0755
kreadconfig5 File 66.09 KB 0755
kshell5 File 66.08 KB 0755
ktelnetservice5 File 66.08 KB 0755
ktrash5 File 66.08 KB 0755
kwallet-query File 66.16 KB 0755
kwalletd5 File 578.27 KB 0755
kwrapper5 File 66.08 KB 0755
kwriteconfig5 File 66.09 KB 0755
l2ping File 66.09 KB 0755
l2test File 66.41 KB 0755
labwc File 514.95 KB 0755
labwc-pi File 391 B 0755
labwc-prompt File 66.18 KB 0755
lame File 130.18 KB 0755
laptop-detect File 3.73 KB 0755
last File 66.16 KB 0755
lastb File 66.16 KB 0755
lastlog File 67.55 KB 0755
lc-compliance File 514.27 KB 0755
lcf File 7.6 KB 0755
ld File 1.63 MB 0755
ld.bfd File 1.63 MB 0755
ld.gold File 5.26 MB 0755
ld.so File 198.16 KB 0755
ldd File 5.19 KB 0755
leaftoppm File 65.8 KB 0755
less File 209.96 KB 0755
lessecho File 66.1 KB 0755
lessfile File 8.83 KB 0755
lesskey File 67.48 KB 0755
lesspipe File 8.83 KB 0755
letsencrypt File 958 B 0755
lexgrog File 131.28 KB 0755
libcamerify File 844 B 0755
libinput File 67.37 KB 0755
libnetcfg File 15.41 KB 0755
libpng-config File 2.41 KB 0755
libpng16-config File 2.41 KB 0755
libsixel-config File 1.81 KB 0755
link File 66.8 KB 0755
linux-check-removal File 4.56 KB 0755
linux-update-symlinks File 6.17 KB 0755
linux-version File 2.63 KB 0755
linux32 File 66.41 KB 0755
linux64 File 66.41 KB 0755
lispmtopgm File 65.8 KB 0755
ln File 67.05 KB 0755
lnstat File 66.43 KB 0755
loadkeys File 259.43 KB 0755
loadunimap File 66.88 KB 0755
locale File 73.91 KB 0755
localectl File 66.23 KB 0755
localedef File 331.92 KB 0755
logger File 66.73 KB 0755
logilab-pytest File 134 B 0755
login File 67.59 KB 0755
loginctl File 66.38 KB 0755
logname File 66.8 KB 0755
logresolve File 66.09 KB 0755
look File 66.16 KB 0755
lowntfs-3g File 130.77 KB 0755
lp File 66.09 KB 0755
lp-connection-editor File 841.9 KB 0755
lp_solve File 46.86 KB 0755
lpoptions File 66.16 KB 0755
lpstat File 66.37 KB 0755
ls File 195.74 KB 0755
lsattr File 66.09 KB 0755
lsb_release File 2.59 KB 0755
lsblk File 258.16 KB 0755
lscpu File 130.16 KB 0755
lsfd File 132.14 KB 0755
lsinitramfs File 735 B 0755
lsipc File 130.16 KB 0755
lsirq File 66.33 KB 0755
lslocks File 130.54 KB 0755
lslogins File 130.19 KB 0755
lsmem File 130.16 KB 0755
lsmod File 194.28 KB 0755
lsns File 130.16 KB 0755
lsof File 203.44 KB 0755
lspci File 131.85 KB 0755
lspgpot File 1.06 KB 0755
lsusb File 295 KB 0755
lto-dump File 25.77 MB 0755
lto-dump-12 File 25.77 MB 0755
lua File 198.95 KB 0755
lua5.1 File 198.95 KB 0755
luac File 126.45 KB 0755
luac5.1 File 126.45 KB 0755
luajit File 578.96 KB 0755
lwp-download File 10.05 KB 0755
lwp-dump File 2.65 KB 0755
lwp-mirror File 2.36 KB 0755
lwp-request File 15.82 KB 0755
lwrespawn File 135 B 0755
lxappearance File 51.67 KB 0755
lxclipboard File 66.16 KB 0755
lxde-logout File 90 B 0755
lxhotkey File 17.93 KB 0755
lxpanel File 195.77 KB 0755
lxpanelctl File 65.93 KB 0755
lxpolkit File 66.01 KB 0755
lxrandr File 25.93 KB 0755
lxsession File 322.23 KB 0755
lxsession-db File 66.16 KB 0755
lxsession-default File 9 KB 0755
lxsession-default-terminal File 1019 B 0755
lxsession-edit File 65.93 KB 0755
lxsession-logout File 66.12 KB 0755
lxsession-xdg-autostart File 66.16 KB 0755
lxtask File 65.93 KB 0755
lxterminal File 133.39 KB 0755
lynx File 1.92 MB 0755
lzcat File 130.51 KB 0755
lzcmp File 7.25 KB 0755
lzdiff File 7.25 KB 0755
lzegrep File 10.09 KB 0755
lzfgrep File 10.09 KB 0755
lzgrep File 10.09 KB 0755
lzless File 1.77 KB 0755
lzma File 130.51 KB 0755
lzmainfo File 66.16 KB 0755
lzmore File 2.14 KB 0755
mac2unix File 54.09 KB 0755
macptopbm File 65.8 KB 0755
make File 238.46 KB 0755
make-first-existing-target File 4.79 KB 0755
makeconv File 66.85 KB 0755
malcontent-client File 22.54 KB 0755
malcontent-control File 66.12 KB 0755
man File 133.16 KB 0755
man-recode File 67.14 KB 0755
mandb File 195.43 KB 0755
manpath File 66.55 KB 0755
mapscrn File 66.88 KB 0755
mariadb File 5.05 MB 0755
mariadb-access File 109.31 KB 0755
mariadb-admin File 4.83 MB 0755
mariadb-analyze File 4.83 MB 0755
mariadb-binlog File 5.09 MB 0755
mariadb-check File 4.83 MB 0755
mariadb-conv File 4.57 MB 0755
mariadb-convert-table-format File 4.12 KB 0755
mariadb-dump File 4.96 MB 0755
mariadb-dumpslow File 8.05 KB 0755
mariadb-find-rows File 3.21 KB 0755
mariadb-fix-extensions File 1.22 KB 0755
mariadb-hotcopy File 34.53 KB 0755
mariadb-import File 4.83 MB 0755
mariadb-install-db File 22.13 KB 0755
mariadb-optimize File 4.83 MB 0755
mariadb-plugin File 4.57 MB 0755
mariadb-repair File 4.83 MB 0755
mariadb-report File 49.02 KB 0755
mariadb-secure-installation File 13.49 KB 0755
mariadb-service-convert File 2.45 KB 0755
mariadb-setpermission File 17.56 KB 0755
mariadb-show File 4.83 MB 0755
mariadb-slap File 4.83 MB 0755
mariadb-tzinfo-to-sql File 4.57 MB 0755
mariadb-upgrade File 4.96 MB 0755
mariadb-waitpid File 4.51 MB 0755
mariadbcheck File 4.83 MB 0755
mariadbd-multi File 26.69 KB 0755
mariadbd-safe File 30.42 KB 0755
mariadbd-safe-helper File 4.51 MB 0755
markdown-it File 220 B 0755
markdown_py File 969 B 0755
mate-polkit File 61 B 0755
mawk File 150.49 KB 0755
mbim-network File 11.08 KB 0755
mbimcli File 199.46 KB 0755
mcookie File 66.23 KB 0755
md5sum File 66.91 KB 0755
md5sum.textutils File 66.91 KB 0755
mdatopbm File 65.8 KB 0755
mdig File 66.18 KB 0755
media-ctl File 66.78 KB 0755
melt File 65.93 KB 0755
melt-7 File 65.93 KB 0755
memusage File 7.3 KB 0755
memusagestat File 66.42 KB 0755
mencoder File 2.57 MB 0755
mesa-overlay-control.py File 5.59 KB 0755
mesg File 66.16 KB 0755
meson File 903 B 0755
mgrtopbm File 65.8 KB 0755
migrate-pubring-from-classic-gpg File 2.99 KB 0755
mk_modmap File 15.78 KB 0755
mkdir File 131.23 KB 0755
mkfifo File 67.13 KB 0755
mkfontdir File 65 B 0755
mkfontscale File 34.9 KB 0755
mkisofs File 665.41 KB 0755
mknod File 67.16 KB 0755
mktemp File 66.87 KB 0755
mkvextract File 3.57 MB 0755
mkvinfo File 2.7 MB 0755
mkvmerge File 6.14 MB 0755
mkvpropedit File 3.01 MB 0755
mkzftree File 66.66 KB 0755
mmcli File 265.49 KB 0755
modeline2fb File 4.31 KB 0755
mogrify File 66.09 KB 0755
mogrify-im6 File 66.09 KB 0755
mogrify-im6.q16 File 66.09 KB 0755
monitor-sensor File 14.09 KB 0755
montage File 66.09 KB 0755
montage-im6 File 66.09 KB 0755
montage-im6.q16 File 66.09 KB 0755
more File 66.16 KB 0755
mount File 66.16 KB 4755
mountpoint File 66.16 KB 0755
mousepad File 66.09 KB 0755
mpeg2desc File 66.17 KB 0755
mplayer File 3.01 MB 0755
mpris-proxy File 130.35 KB 0755
mrftopbm File 65.8 KB 0755
msql2mysql File 1.41 KB 0755
mt File 131.12 KB 0755
mt-gnu File 131.12 KB 0755
mtrace File 6.35 KB 0755
mtvtoppm File 65.8 KB 0755
mv File 131.57 KB 0755
mvxattr File 66.08 KB 0755
my_print_defaults File 4.51 MB 0755
myisam_ftdump File 4.83 MB 0755
myisamchk File 4.96 MB 0755
myisamlog File 4.83 MB 0755
myisampack File 4.89 MB 0755
mypy File 230 B 0755
mypyc File 213 B 0755
mysql File 5.05 MB 0755
mysql_convert_table_format File 4.12 KB 0755
mysql_find_rows File 3.21 KB 0755
mysql_fix_extensions File 1.22 KB 0755
mysql_install_db File 22.13 KB 0755
mysql_plugin File 4.57 MB 0755
mysql_secure_installation File 13.49 KB 0755
mysql_setpermission File 17.56 KB 0755
mysql_tzinfo_to_sql File 4.57 MB 0755
mysql_upgrade File 4.96 MB 0755
mysql_waitpid File 4.51 MB 0755
mysqlaccess File 109.31 KB 0755
mysqladmin File 4.83 MB 0755
mysqlanalyze File 4.83 MB 0755
mysqlbinlog File 5.09 MB 0755
mysqlcheck File 4.83 MB 0755
mysqld_multi File 26.69 KB 0755
mysqld_safe File 30.42 KB 0755
mysqld_safe_helper File 4.51 MB 0755
mysqldump File 4.96 MB 0755
mysqldumpslow File 8.05 KB 0755
mysqlhotcopy File 34.53 KB 0755
mysqlimport File 4.83 MB 0755
mysqloptimize File 4.83 MB 0755
mysqlrepair File 4.83 MB 0755
mysqlreport File 49.02 KB 0755
mysqlshow File 4.83 MB 0755
mysqlslap File 4.83 MB 0755
mytop File 71.95 KB 0755
named-checkconf File 66.16 KB 0755
named-checkzone File 66.16 KB 0755
named-compilezone File 66.16 KB 0755
named-journalprint File 66.08 KB 0755
named-nzd2nzf File 66.08 KB 0755
named-rrchecker File 66.08 KB 0755
namei File 66.16 KB 0755
nano File 324.64 KB 0755
nawk File 712.3 KB 0755
ncdu File 130.07 KB 0755
ncurses5-config File 8.28 KB 0755
ncurses6-config File 8.28 KB 0755
ncursesw5-config File 8.28 KB 0755
ncursesw6-config File 8.28 KB 0755
neofetch File 333.58 KB 0755
neotoppm File 65.8 KB 0755
neqn File 913 B 0755
net File 1.02 MB 0755
netstat File 199.34 KB 0755
networkctl File 130.49 KB 0755
newgrp File 67.55 KB 4755
ngettext File 66.16 KB 0755
nice File 66.84 KB 0755
ninja File 323.49 KB 0755
nisdomainname File 66.01 KB 0755
nl File 131.08 KB 0755
nm File 67.84 KB 0755
nm-applet File 259.98 KB 0755
nm-connection-editor File 770.78 KB 0755
nm-online File 66.08 KB 0755
nmblookup File 194.26 KB 0755
nmcli File 1007.52 KB 0755
nmtui File 805.5 KB 0755
nmtui-connect File 805.5 KB 0755
nmtui-edit File 805.5 KB 0755
nmtui-hostname File 805.5 KB 0755
nohup File 66.86 KB 0755
noip-duc File 2.51 MB 0755
normalizer File 244 B 0755
nproc File 66.85 KB 0755
nroff File 3.22 KB 0755
nsec3hash File 66.09 KB 0755
nsenter File 66.38 KB 0755
nslookup File 130.55 KB 0755
nstat File 144.27 KB 0755
nsupdate File 66.29 KB 0755
ntfs-3g File 194.8 KB 4755
ntfs-3g.probe File 66.16 KB 0755
ntfscat File 66.19 KB 0755
ntfscluster File 66.19 KB 0755
ntfscmp File 66.19 KB 0755
ntfsdecrypt File 66.2 KB 0755
ntfsfallocate File 66.2 KB 0755
ntfsfix File 66.29 KB 0755
ntfsinfo File 66.2 KB 0755
ntfsls File 67.24 KB 0755
ntfsmove File 66.19 KB 0755
ntfsrecover File 130.28 KB 0755
ntfssecaudit File 130.66 KB 0755
ntfstruncate File 66.12 KB 0755
ntfsusermap File 66.11 KB 0755
ntfswipe File 66.7 KB 0755
ntpmon File 20.7 KB 0755
ntpq File 69.28 KB 0755
ntptrace File 5.39 KB 0755
numfmt File 130.98 KB 0755
nvlc File 47 B 0755
oLschema2ldif File 66.08 KB 0755
obamenu File 6.76 KB 0755
obconf File 73.93 KB 0755
obexctl File 130.17 KB 0755
obfs4proxy File 4.87 MB 0755
objcopy File 199.55 KB 0755
objdump File 394.5 KB 0755
obxprop File 66.08 KB 0755
od File 130.96 KB 0755
ogg123 File 131.48 KB 0755
oggdec File 66.45 KB 0755
oggenc File 131.88 KB 0755
ogginfo File 66.17 KB 0755
open File 25.46 KB 0755
openbox File 387.55 KB 0755
openbox-lxde File 77 B 0755
openbox-lxde-pi File 80 B 0755
openbox-session File 595 B 0755
openocd File 4.16 MB 0755
openssl File 992.91 KB 0755
openvt File 66.98 KB 0755
otpset File 5.79 KB 0755
overlaycheck File 25.35 KB 0755
ovmerge File 46.81 KB 0755
p11-kit File 66.17 KB 0755
p7zip File 4.64 KB 0755
pa-info File 2.29 KB 0755
pacat File 66.2 KB 0755
pacmd File 66.16 KB 0755
pactl File 130.18 KB 0755
padsp File 2.18 KB 0755
pager File 209.96 KB 0755
palmtopnm File 65.8 KB 0755
pamaddnoise File 65.8 KB 0755
pamaltsat File 65.84 KB 0755
pamarith File 65.8 KB 0755
pambackground File 65.8 KB 0755
pambayer File 65.88 KB 0755
pambrighten File 65.8 KB 0755
pamcat File 65.8 KB 0755
pamchannel File 65.8 KB 0755
pamcomp File 65.8 KB 0755
pamcrater File 65.8 KB 0755
pamcut File 65.8 KB 0755
pamdeinterlace File 65.8 KB 0755
pamdepth File 65.8 KB 0755
pamdice File 65.8 KB 0755
pamditherbw File 65.81 KB 0755
pamedge File 65.8 KB 0755
pamendian File 65.8 KB 0755
pamenlarge File 65.88 KB 0755
pamexec File 65.8 KB 0755
pamfile File 65.8 KB 0755
pamfind File 65.8 KB 0755
pamfix File 65.8 KB 0755
pamfixtrunc File 2.01 KB 0755
pamflip File 65.8 KB 0755
pamfunc File 65.8 KB 0755
pamgauss File 65.8 KB 0755
pamgetcolor File 65.88 KB 0755
pamgradient File 65.8 KB 0755
pamhomography File 65.8 KB 0755
pamhue File 65.8 KB 0755
pamlevels File 65.8 KB 0755
pamlookup File 65.8 KB 0755
pammasksharpen File 65.8 KB 0755
pammixinterlace File 65.88 KB 0755
pammixmulti File 65.8 KB 0755
pammosaicknit File 65.8 KB 0755
pamoil File 65.8 KB 0755
pamon File 66.2 KB 0755
pampaintspill File 65.8 KB 0755
pamperspective File 65.88 KB 0755
pampick File 65.8 KB 0755
pampop9 File 65.8 KB 0755
pamrecolor File 65.8 KB 0755
pamrestack File 65.8 KB 0755
pamrgbatopng File 65.8 KB 0755
pamrubber File 65.8 KB 0755
pamscale File 65.88 KB 0755
pamseq File 65.8 KB 0755
pamshadedrelief File 65.8 KB 0755
pamsharpmap File 65.8 KB 0755
pamsharpness File 65.8 KB 0755
pamshuffle File 65.8 KB 0755
pamsistoaglyph File 65.8 KB 0755
pamslice File 65.8 KB 0755
pamsplit File 65.8 KB 0755
pamstack File 65.8 KB 0755
pamstereogram File 65.8 KB 0755
pamstretch File 65.8 KB 0755
pamstretch-gen File 3.83 KB 0755
pamsumm File 65.8 KB 0755
pamsummcol File 65.8 KB 0755
pamtable File 65.8 KB 0755
pamthreshold File 65.8 KB 0755
pamtilt File 65.8 KB 0755
pamtoavs File 65.8 KB 0755
pamtodjvurle File 65.8 KB 0755
pamtofits File 65.8 KB 0755
pamtogif File 65.8 KB 0755
pamtohdiff File 65.8 KB 0755
pamtohtmltbl File 65.8 KB 0755
pamtojpeg2k File 264.27 KB 0755
pamtompfont File 65.8 KB 0755
pamtooctaveimg File 65.8 KB 0755
pamtopam File 65.8 KB 0755
pamtopdbimg File 65.88 KB 0755
pamtopfm File 65.8 KB 0755
pamtopng File 65.8 KB 0755
pamtopnm File 65.8 KB 0755
pamtoqoi File 65.8 KB 0755
pamtosrf File 65.8 KB 0755
pamtosvg File 65.8 KB 0755
pamtotga File 65.8 KB 0755
pamtotiff File 65.88 KB 0755
pamtouil File 65.8 KB 0755
pamtowinicon File 65.8 KB 0755
pamtoxvmini File 65.8 KB 0755
pamtris File 65.8 KB 0755
pamundice File 65.8 KB 0755
pamunlookup File 65.8 KB 0755
pamvalidate File 65.8 KB 0755
pamwipeout File 65.8 KB 0755
pamx File 65.88 KB 0755
pandoc File 214.26 MB 0755
paperconf File 66.23 KB 0755
paplay File 66.2 KB 0755
parec File 66.2 KB 0755
parecord File 66.2 KB 0755
parse-edid File 21.73 KB 0755
partx File 130.16 KB 0755
passwd File 70.36 KB 4755
paste File 66.84 KB 0755
pastebinit File 16.31 KB 0755
pasuspender File 66.17 KB 0755
patch File 183.36 KB 0755
pathchk File 66.82 KB 0755
pax11publish File 66.09 KB 0755
pbget File 2.51 KB 0755
pbmclean File 65.8 KB 0755
pbmlife File 65.8 KB 0755
pbmmake File 65.8 KB 0755
pbmmask File 65.8 KB 0755
pbmminkowski File 65.8 KB 0755
pbmnoise File 65.8 KB 0755
pbmpage File 65.8 KB 0755
pbmpscale File 65.8 KB 0755
pbmreduce File 65.8 KB 0755
pbmtext File 65.97 KB 0755
pbmtextps File 65.8 KB 0755
pbmto10x File 65.8 KB 0755
pbmto4425 File 65.8 KB 0755
pbmtoascii File 65.8 KB 0755
pbmtoatk File 65.8 KB 0755
pbmtobbnbg File 65.8 KB 0755
pbmtocis File 65.8 KB 0755
pbmtocmuwm File 65.8 KB 0755
pbmtodjvurle File 65.8 KB 0755
pbmtoepsi File 65.8 KB 0755
pbmtoepson File 65.8 KB 0755
pbmtoescp2 File 65.8 KB 0755
pbmtog3 File 66.63 KB 0755
pbmtogem File 65.8 KB 0755
pbmtogo File 65.8 KB 0755
pbmtoibm23xx File 65.8 KB 0755
pbmtoicon File 65.8 KB 0755
pbmtolj File 65.8 KB 0755
pbmtoln03 File 65.8 KB 0755
pbmtolps File 65.8 KB 0755
pbmtomacp File 65.8 KB 0755
pbmtomatrixorbital File 65.8 KB 0755
pbmtomda File 65.8 KB 0755
pbmtomgr File 65.8 KB 0755
pbmtomrf File 65.8 KB 0755
pbmtonokia File 65.8 KB 0755
pbmtopgm File 65.8 KB 0755
pbmtopi3 File 65.8 KB 0755
pbmtopk File 66.09 KB 0755
pbmtoplot File 65.8 KB 0755
pbmtoppa File 65.88 KB 0755
pbmtopsg3 File 67.43 KB 0755
pbmtoptx File 65.8 KB 0755
pbmtosunicon File 65.8 KB 0755
pbmtowbmp File 65.8 KB 0755
pbmtox10bm File 2.83 KB 0755
pbmtoxbm File 65.8 KB 0755
pbmtoybm File 65.8 KB 0755
pbmtozinc File 65.8 KB 0755
pbmupc File 65.8 KB 0755
pbput File 2.51 KB 0755
pbputs File 2.51 KB 0755
pc1toppm File 65.8 KB 0755
pcdindex File 6.56 KB 0755
pcdovtoppm File 6.56 KB 0755
pcmanfm File 327.73 KB 0755
pcre-config File 2.29 KB 0755
pcre2-config File 1.93 KB 0755
pcxtoppm File 65.8 KB 0755
pdb3 File 62.4 KB 0755
pdb3.11 File 62.4 KB 0755
pdbedit File 66.08 KB 0755
pdbimgtopam File 65.88 KB 0755
pdf2dsc File 698 B 0755
pdf2ps File 909 B 0755
pdfattach File 66.16 KB 0755
pdfdetach File 66.24 KB 0755
pdffonts File 66.25 KB 0755
pdfimages File 66.25 KB 0755
pdfinfo File 66.26 KB 0755
pdfseparate File 66.16 KB 0755
pdfsig File 66.52 KB 0755
pdftocairo File 194.24 KB 0755
pdftohtml File 130.23 KB 0755
pdftoppm File 66.2 KB 0755
pdftops File 66.27 KB 0755
pdftotext File 66.27 KB 0755
pdfunite File 66.16 KB 0755
pear File 793 B 0755
peardev File 814 B 0755
pecl File 727 B 0755
peekfd File 66.63 KB 0755
perl File 3.51 MB 0755
perl5.36-aarch64-linux-gnu File 66.29 KB 0755
perl5.36.0 File 3.51 MB 0755
perlbug File 44.12 KB 0755
perldoc File 125 B 0755
perlivp File 10.61 KB 0755
perlthanks File 44.12 KB 0755
perror File 4.73 MB 0755
pf2afm File 498 B 0755
pfbtopfa File 516 B 0755
pfmtopam File 65.8 KB 0755
pgmabel File 65.8 KB 0755
pgmbentley File 65.8 KB 0755
pgmcrater File 3.49 KB 0755
pgmdeshadow File 65.8 KB 0755
pgmedge File 65.8 KB 0755
pgmenhance File 65.8 KB 0755
pgmhist File 65.8 KB 0755
pgmkernel File 65.8 KB 0755
pgmmake File 65.8 KB 0755
pgmmedian File 65.8 KB 0755
pgmminkowski File 65.8 KB 0755
pgmmorphconv File 65.8 KB 0755
pgmnoise File 65.8 KB 0755
pgmnorm File 65.8 KB 0755
pgmoil File 65.8 KB 0755
pgmramp File 65.8 KB 0755
pgmslice File 65.8 KB 0755
pgmtexture File 65.8 KB 0755
pgmtofs File 65.8 KB 0755
pgmtolispm File 65.8 KB 0755
pgmtopbm File 65.8 KB 0755
pgmtopgm File 65.8 KB 0755
pgmtoppm File 65.8 KB 0755
pgmtosbig File 65.8 KB 0755
pgmtost4 File 65.8 KB 0755
pgrep File 66.24 KB 0755
pgzrun File 371 B 0755
phar File 14.88 KB 0755
phar.phar File 14.88 KB 0755
phar.phar8.2 File 14.88 KB 0755
phar8.2 File 14.88 KB 0755
phar8.2.phar File 14.88 KB 0755
php File 5.38 MB 0755
php8.2 File 5.38 MB 0755
phpdbg File 5.38 MB 0755
phpdbg8.2 File 5.38 MB 0755
pi-gpk-dbus-service File 196.68 KB 0755
pi-gpk-install-local-file File 67.23 KB 0755
pi-gpk-log File 131.61 KB 0755
pi-gpk-prefs File 131.62 KB 0755
pi-gpk-update-viewer File 197.04 KB 0755
pi-packages File 197.5 KB 0755
pi1toppm File 65.8 KB 0755
pi3topbm File 65.8 KB 0755
pic File 260.11 KB 0755
piclone File 66.53 KB 0755
pico File 324.64 KB 0755
piconv File 8.16 KB 0755
pidof File 66.21 KB 0755
pidwait File 66.24 KB 0755
pig2vcd File 9.97 KB 0755
pigpiod File 14.22 KB 0755
pigs File 43.48 KB 0755
pinctrl File 66.48 KB 0755
pinentry File 130.45 KB 0755
pinentry-curses File 66.45 KB 0755
pinentry-gnome3 File 130.45 KB 0755
pinentry-x11 File 130.45 KB 0755
ping File 144.36 KB 4755
ping4 File 144.36 KB 4755
ping6 File 144.36 KB 4755
pinky File 66.98 KB 0755
pinout File 959 B 0755
pintest File 961 B 0755
pip File 221 B 0755
pip3 File 221 B 0755
pip3.11 File 221 B 0755
pipanel File 131.23 KB 0755
pipewire File 66.16 KB 0755
pipewire-aes67 File 66.16 KB 0755
pipewire-avb File 66.16 KB 0755
pipewire-pulse File 66.16 KB 0755
pishutdown File 66.21 KB 0755
piwiz File 131.74 KB 0755
pjtoppm File 65.81 KB 0755
pkaction File 66.08 KB 0755
pkcheck File 66.08 KB 0755
pkexec File 66.05 KB 4755
pkg-config File 67.88 KB 0755
pkgconf File 67.88 KB 0755
pkgdata File 67.3 KB 0755
pkill File 66.24 KB 0755
pktopbm File 65.8 KB 0755
pkttyagent File 66.08 KB 0755
pl2pm File 4.43 KB 0755
plasmapkg2 File 66.09 KB 0755
play File 66.23 KB 0755
pldd File 66.35 KB 0755
plog File 146 B 0755
plymouth File 66.7 KB 0755
pmap File 66.19 KB 0755
png-fix-itxt File 66.09 KB 0755
pngfix File 66.02 KB 0755
pngtopam File 65.88 KB 0755
pngtopnm File 65.88 KB 0755
pnmalias File 65.8 KB 0755
pnmarith File 65.8 KB 0755
pnmcat File 65.8 KB 0755
pnmcolormap File 65.8 KB 0755
pnmcomp File 65.8 KB 0755
pnmconvol File 65.8 KB 0755
pnmcrop File 65.88 KB 0755
pnmcut File 65.8 KB 0755
pnmdepth File 65.8 KB 0755
pnmenlarge File 65.88 KB 0755
pnmfile File 65.8 KB 0755
pnmflip File 3.63 KB 0755
pnmgamma File 65.8 KB 0755
pnmhisteq File 65.8 KB 0755
pnmhistmap File 65.8 KB 0755
pnmindex File 65.8 KB 0755
pnminterp File 65.8 KB 0755
pnminterp-gen File 3.83 KB 0755
pnminvert File 65.8 KB 0755
pnmmargin File 2.75 KB 0755
pnmmercator File 65.8 KB 0755
pnmmontage File 65.8 KB 0755
pnmnlfilt File 65.85 KB 0755
pnmnoraw File 31 B 0755
pnmnorm File 65.8 KB 0755
pnmpad File 65.8 KB 0755
pnmpaste File 65.8 KB 0755
pnmpsnr File 65.8 KB 0755
pnmquant File 10.63 KB 0755
pnmquantall File 6.84 KB 0755
pnmremap File 65.8 KB 0755
pnmrotate File 65.8 KB 0755
pnmscale File 65.88 KB 0755
pnmscalefixed File 65.8 KB 0755
pnmshear File 65.8 KB 0755
pnmsmooth File 65.8 KB 0755
pnmsplit File 65.8 KB 0755
pnmstitch File 66.52 KB 0755
pnmtile File 65.8 KB 0755
pnmtoddif File 65.8 KB 0755
pnmtofiasco File 195.65 KB 0755
pnmtofits File 65.8 KB 0755
pnmtojbig File 76.63 KB 0755
pnmtojpeg File 65.8 KB 0755
pnmtopalm File 65.8 KB 0755
pnmtopclxl File 66.3 KB 0755
pnmtoplainpnm File 31 B 0755
pnmtopng File 65.8 KB 0755
pnmtopnm File 65.8 KB 0755
pnmtops File 65.8 KB 0755
pnmtorast File 65.8 KB 0755
pnmtorle File 66.04 KB 0755
pnmtosgi File 65.8 KB 0755
pnmtosir File 65.8 KB 0755
pnmtotiff File 65.88 KB 0755
pnmtotiffcmyk File 65.88 KB 0755
pnmtoxwd File 65.8 KB 0755
pod2html File 4.04 KB 0755
pod2man File 14.68 KB 0755
pod2text File 10.55 KB 0755
pod2usage File 4.01 KB 0755
podchecker File 3.57 KB 0755
poff File 2.77 KB 0755
pon File 1.33 KB 0755
powerprofilesctl File 8.62 KB 0755
ppdc File 130.3 KB 0755
ppdhtml File 130.3 KB 0755
ppdi File 130.3 KB 0755
ppdmerge File 66.16 KB 0755
ppdpo File 130.3 KB 0755
pphs File 404 B 0755
ppm3d File 65.8 KB 0755
ppmbrighten File 2 KB 0755
ppmchange File 65.8 KB 0755
ppmcie File 65.96 KB 0755
ppmcolormask File 65.8 KB 0755
ppmcolors File 65.8 KB 0755
ppmdcfont File 65.8 KB 0755
ppmddumpfont File 65.8 KB 0755
ppmdim File 65.8 KB 0755
ppmdist File 65.8 KB 0755
ppmdither File 65.8 KB 0755
ppmdmkfont File 69.25 KB 0755
ppmdraw File 65.8 KB 0755
ppmfade File 11.78 KB 0755
ppmflash File 65.8 KB 0755
ppmforge File 65.8 KB 0755
ppmglobe File 65.8 KB 0755
ppmhist File 65.8 KB 0755
ppmlabel File 65.8 KB 0755
ppmmake File 65.8 KB 0755
ppmmix File 65.8 KB 0755
ppmnorm File 65.8 KB 0755
ppmntsc File 65.8 KB 0755
ppmpat File 65.8 KB 0755
ppmquant File 2.3 KB 0755
ppmquantall File 6.84 KB 0755
ppmrainbow File 3.48 KB 0755
ppmrelief File 65.8 KB 0755
ppmrough File 65.8 KB 0755
ppmshadow File 10.85 KB 0755
ppmshift File 65.8 KB 0755
ppmspread File 65.8 KB 0755
ppmtoacad File 66.63 KB 0755
ppmtoapplevol File 65.8 KB 0755
ppmtoarbtxt File 65.8 KB 0755
ppmtoascii File 65.88 KB 0755
ppmtobmp File 65.8 KB 0755
ppmtoeyuv File 65.8 KB 0755
ppmtogif File 65.8 KB 0755
ppmtoicr File 65.8 KB 0755
ppmtoilbm File 65.89 KB 0755
ppmtojpeg File 65.8 KB 0755
ppmtoleaf File 65.8 KB 0755
ppmtolj File 65.8 KB 0755
ppmtomap File 82 B 0755
ppmtomitsu File 65.8 KB 0755
ppmtompeg File 489.51 KB 0755
ppmtoneo File 65.8 KB 0755
ppmtopcx File 65.8 KB 0755
ppmtopgm File 65.8 KB 0755
ppmtopi1 File 65.8 KB 0755
ppmtopict File 65.8 KB 0755
ppmtopj File 65.88 KB 0755
ppmtopjxl File 65.88 KB 0755
ppmtoppm File 65.8 KB 0755
ppmtopuzz File 65.8 KB 0755
ppmtorgb3 File 65.8 KB 0755
ppmtosixel File 65.8 KB 0755
ppmtospu File 65.8 KB 0755
ppmtoterm File 65.8 KB 0755
ppmtotga File 65.8 KB 0755
ppmtouil File 65.8 KB 0755
ppmtowinicon File 65.8 KB 0755
ppmtoxpm File 65.8 KB 0755
ppmtoyuv File 65.8 KB 0755
ppmtoyuvsplit File 65.8 KB 0755
ppmtv File 65.8 KB 0755
ppmwheel File 65.8 KB 0755
pprompt.sh File 336 B 0755
pr File 131.08 KB 0755
preconv File 66.29 KB 0755
preparetips5 File 1019 B 0755
print File 18.06 KB 0755
printafm File 395 B 0755
printenv File 66.8 KB 0755
printf File 66.88 KB 0755
prlimit File 66.66 KB 0755
procan File 131.73 KB 0755
profiles File 66.08 KB 0755
proj File 66.19 KB 0755
projinfo File 130.18 KB 0755
projsync File 130.26 KB 0755
protocoltojson File 66.08 KB 0755
prove File 13.34 KB 0755
proxy File 65.93 KB 0755
prtstat File 66.55 KB 0755
ps File 194.78 KB 0755
ps2ascii File 631 B 0755
ps2epsi File 1.23 KB 0755
ps2pdf File 272 B 0755
ps2pdf12 File 215 B 0755
ps2pdf13 File 215 B 0755
ps2pdf14 File 215 B 0755
ps2pdfwr File 1.05 KB 0755
ps2ps File 647 B 0755
ps2ps2 File 669 B 0755
ps2txt File 631 B 0755
psfaddtable File 66.5 KB 0755
psfgettable File 66.5 KB 0755
psfstriptable File 66.5 KB 0755
psfxtable File 66.5 KB 0755
psidtopgm File 65.8 KB 0755
pslog File 66.34 KB 0755
pstopnm File 65.8 KB 0755
pstree File 67.59 KB 0755
pstree.x11 File 67.59 KB 0755
ptar File 3.48 KB 0755
ptardiff File 2.58 KB 0755
ptargrep File 4.29 KB 0755
ptx File 131.17 KB 0755
pv File 71.81 KB 0755
pw-cat File 194.16 KB 0755
pw-cli File 130.26 KB 0755
pw-config File 66.16 KB 0755
pw-container File 66.16 KB 0755
pw-dot File 66.16 KB 0755
pw-dsdplay File 194.16 KB 0755
pw-dump File 130.23 KB 0755
pw-encplay File 194.16 KB 0755
pw-link File 66.16 KB 0755
pw-loopback File 66.16 KB 0755
pw-metadata File 66.16 KB 0755
pw-mididump File 66.16 KB 0755
pw-midiplay File 194.16 KB 0755
pw-midirecord File 194.16 KB 0755
pw-mon File 130.2 KB 0755
pw-play File 194.16 KB 0755
pw-profiler File 66.16 KB 0755
pw-record File 194.16 KB 0755
pw-reserve File 66.16 KB 0755
pw-top File 130.16 KB 0755
pwd File 66.89 KB 0755
pwdx File 66.16 KB 0755
pwrkey File 170 B 0755
py3clean File 7.63 KB 0755
py3compile File 13 KB 0755
py3versions File 12.52 KB 0755
pyav File 210 B 0755
pybabel File 956 B 0755
pybabel-python3 File 956 B 0755
pydoc File 79 B 0755
pydoc3 File 79 B 0755
pydoc3.11 File 79 B 0755
pygettext3 File 23.67 KB 0755
pygettext3.11 File 23.67 KB 0755
pygmentize File 970 B 0755
pylint File 217 B 0755
pylint-config File 233 B 0755
pyreverse File 223 B 0755
pyserial-miniterm File 975 B 0755
pyserial-ports File 969 B 0755
python File 6.31 MB 0755
python-dotenv File 977 B 0755
python3 File 6.31 MB 0755
python3-config File 3.01 KB 0755
python3.11 File 6.31 MB 0755
python3.11-config File 3.01 KB 0755
pzstd File 642.34 KB 0755
qcam File 322.99 KB 0755
qmi-firmware-update File 195.8 KB 0755
qmi-network File 16.04 KB 0755
qmicli File 589.67 KB 0755
qoitopam File 65.8 KB 0755
qrttoppm File 65.8 KB 0755
qt-faststart File 66.08 KB 0755
qt5ct File 642.25 KB 0755
qvlc File 42 B 0755
r File 175.1 KB 0755
raindrop File 67.55 KB 0755
ranlib File 67.01 KB 0755
raspi-config File 127.15 KB 0755
raspi-gpio File 71.55 KB 0755
raspinfo File 5.8 KB 0755
rasputin File 66.77 KB 0755
rasttopnm File 65.8 KB 0755
rawtopgm File 65.8 KB 0755
rawtoppm File 65.8 KB 0755
rbash File 1.28 MB 0755
rc_gui File 66.93 KB 0755
rctest File 66.12 KB 0755
rdjpgcom File 66.09 KB 0755
rdma File 208.41 KB 0755
rds-ctl File 66.88 KB 0755
readelf File 779.36 KB 0755
readlink File 66.85 KB 0755
realpath File 66.86 KB 0755
rec File 66.23 KB 0755
recordmydesktop File 87.72 KB 0755
red File 89 B 0755
regexp-assemble File 4.92 KB 0755
rename-user File 2.56 KB 0755
rename.ul File 66.16 KB 0755
renice File 66.16 KB 0755
replace File 4.51 MB 0755
reset File 66.09 KB 0755
resizepart File 130.16 KB 0755
resolve_stack_dump File 4.51 MB 0755
resolveip File 4.51 MB 0755
rev File 66.16 KB 0755
rfcomm File 66.5 KB 0755
rgb3toppm File 65.8 KB 0755
rgrep File 30 B 0755
rlatopam File 65.8 KB 0755
rletopnm File 66.05 KB 0755
rm File 66.98 KB 0755
rmdir File 66.88 KB 0755
rnano File 324.64 KB 0755
rotatelogs File 66.16 KB 0755
routel File 1.62 KB 0755
rp-bookshelf File 67.39 KB 0755
rp-prefapps File 67.16 KB 0755
rpcgen File 130.84 KB 0755
rpcinfo File 66.45 KB 0755
rpi-bootloader-key-convert File 1.37 KB 0755
rpi-connect File 7.69 MB 0755
rpi-connect-env File 216 B 0755
rpi-connectd File 12.75 MB 0755
rpi-eeprom-config File 23.46 KB 0755
rpi-eeprom-digest File 5.12 KB 0755
rpi-eeprom-update File 36.12 KB 0755
rpi-imager File 37 MB 0755
rpi-otp-private-key File 6.08 KB 0755
rpi-sign-bootcode File 10.86 KB 0755
rpi-update File 18.33 KB 0755
rpicam-hello File 66.62 KB 0755
rpicam-jpeg File 131.03 KB 0755
rpicam-raw File 195.13 KB 0755
rpicam-still File 195.36 KB 0755
rpicam-vid File 195.16 KB 0755
rpinters File 327.82 KB 0755
rrsync File 12.34 KB 0755
rst-buildhtml File 11.17 KB 0755
rst2html File 592 B 0755
rst2html4 File 714 B 0755
rst2html5 File 1.03 KB 0755
rst2latex File 791 B 0755
rst2man File 614 B 0755
rst2odt File 780 B 0755
rst2odt_prepstyles File 2.01 KB 0755
rst2pseudoxml File 599 B 0755
rst2s5 File 635 B 0755
rst2xetex File 871 B 0755
rst2xml File 600 B 0755
rstpep2html File 668 B 0755
rsync File 529.99 KB 0755
rsync-ssl File 5.02 KB 0755
rtstat File 66.43 KB 0755
run-mailcap File 18.06 KB 0755
run-parts File 66.79 KB 0755
runcon File 66.93 KB 0755
rview File 1.65 MB 0755
rvlc File 42 B 0755
rygel File 66.16 KB 0755
samba-regedit File 131.1 KB 0755
samba-tool File 1.52 KB 0755
sane-find-scanner File 195.11 KB 0755
savelog File 10.24 KB 0755
sbigtopgm File 65.8 KB 0755
sbout File 113 B 0755
sbtest File 186 B 0755
scalar File 2.16 MB 0755
scanimage File 67.04 KB 0755
scp File 322.48 KB 0755
scp-dbus-service File 90 B 0755
screendump File 66.36 KB 0755
script File 130.16 KB 0755
scriptlive File 66.16 KB 0755
scriptreplay File 66.16 KB 0755
scrot File 67.1 KB 0755
sdiff File 66.95 KB 0755
sdptool File 137.63 KB 0755
sed File 131.38 KB 0755
see File 18.06 KB 0755
select-default-iwrap File 474 B 0755
select-editor File 2.39 KB 0755
send2trash File 218 B 0755
sensible-browser File 1.26 KB 0755
sensible-editor File 1.24 KB 0755
sensible-pager File 565 B 0755
seq File 66.89 KB 0755
sessreg File 66.4 KB 0755
setarch File 66.41 KB 0755
setcifsacl File 66.09 KB 0755
setfacl File 66.68 KB 0755
setfattr File 66.37 KB 0755
setfont File 66.76 KB 0755
setkeycodes File 66.53 KB 0755
setleds File 66.52 KB 0755
setlogcons File 66.41 KB 0755
setmetamode File 66.64 KB 0755
setpci File 66.24 KB 0755
setpriv File 130.16 KB 0755
setsid File 66.16 KB 0755
setterm File 66.16 KB 0755
setup_env File 565 B 0755
setupcon File 39.17 KB 0755
setvtrgb File 66.63 KB 0755
setxkbmap File 22.88 KB 0755
sftp File 322.46 KB 0755
sg File 67.55 KB 4755
sgitopnm File 65.8 KB 0755
sh File 130.51 KB 0755
sha1sum File 66.91 KB 0755
sha224sum File 66.91 KB 0755
sha256sum File 66.91 KB 0755
sha384sum File 66.91 KB 0755
sha512sum File 66.91 KB 0755
sharesec File 66.16 KB 0755
shasum File 9.75 KB 0755
showconsolefont File 66.64 KB 0755
showkey File 66.63 KB 0755
showrgb File 66.28 KB 0755
shred File 67.07 KB 0755
shuf File 66.97 KB 0755
sirtopnm File 65.8 KB 0755
sixel2png File 10.09 KB 0755
size File 66.71 KB 0755
skill File 66.2 KB 0755
slabtop File 66.21 KB 0755
sldtoppm File 65.86 KB 0755
sleep File 66.83 KB 0755
slogin File 1.13 MB 0755
smb2-quota File 6.3 KB 0755
smbcontrol File 66.35 KB 0755
smbinfo File 28.64 KB 0755
smbpasswd File 66.16 KB 0755
smbstatus File 130.16 KB 0755
snice File 66.2 KB 0755
socat File 453.92 KB 0755
soelim File 66.29 KB 0755
sort File 131.62 KB 0755
sotruss File 4.19 KB 0755
sox File 66.23 KB 0755
soxi File 66.23 KB 0755
spa-acp-tool File 323.88 KB 0755
spa-inspect File 130.25 KB 0755
spa-json-dump File 66.16 KB 0755
spa-monitor File 66.25 KB 0755
spa-resample File 66.38 KB 0755
spctoppm File 65.8 KB 0755
speaker-test File 66.22 KB 0755
splain File 18.99 KB 0755
split File 67.51 KB 0755
splitfont File 66.27 KB 0755
spottopgm File 65.82 KB 0755
sprof File 66.55 KB 0755
spumux File 196.07 KB 0755
sputoppm File 65.8 KB 0755
spuunmux File 130.16 KB 0755
squeekboard File 31.45 MB 0755
squeekboard-restyled File 428 B 0755
srftopam File 65.8 KB 0755
ss File 208.91 KB 0755
ssconvert File 66.16 KB 0755
ssdiff File 66.16 KB 0755
ssgrep File 66.16 KB 0755
ssh File 1.13 MB 0755
ssh-add File 578.3 KB 0755
ssh-agent File 514.23 KB 2755
ssh-argv0 File 1.42 KB 0755
ssh-copy-id File 12.38 KB 0755
ssh-import-id File 409 B 0755
ssh-import-id-gh File 785 B 0755
ssh-import-id-lp File 785 B 0755
ssh-keygen File 706.41 KB 0755
ssh-keyscan File 706.45 KB 0755
sshfs File 132.55 KB 0755
ssindex File 66.16 KB 0755
st4topgm File 65.8 KB 0755
startlxde File 1.46 KB 0755
startlxde-pi File 659 B 0755
startx File 5.39 KB 0755
stat File 131.17 KB 0755
stdbuf File 66.88 KB 0755
strace File 1.56 MB 0755
strace-log-merge File 1.78 KB 0755
stream File 66.09 KB 0755
stream-im6 File 66.09 KB 0755
stream-im6.q16 File 66.09 KB 0755
streamzip File 7.75 KB 0755
strings File 66.84 KB 0755
strip File 199.56 KB 0755
stty File 130.95 KB 0755
stubgen File 211 B 0755
stubtest File 212 B 0755
su File 130.19 KB 4755
sudo File 263 KB 4755
sudoedit File 263 KB 4755
sudopwd File 66.36 KB 0755
sudoreplay File 131.53 KB 0755
sum File 66.93 KB 0755
sunicontopnm File 65.8 KB 0755
svgtopam File 65.8 KB 0755
svlc File 46 B 0755
swayidle File 66.11 KB 0755
swaylock File 132.25 KB 0755
symilar File 219 B 0755
sync File 66.84 KB 0755
systemctl File 1.32 MB 0755
systemd File 130.34 KB 0755
systemd-analyze File 194.76 KB 0755
systemd-ask-password File 66.34 KB 0755
systemd-cat File 66.23 KB 0755
systemd-cgls File 66.34 KB 0755
systemd-cgtop File 66.27 KB 0755
systemd-creds File 66.48 KB 0755
systemd-cryptenroll File 66.46 KB 0755
systemd-delta File 66.23 KB 0755
systemd-detect-virt File 66.23 KB 0755
systemd-escape File 66.23 KB 0755
systemd-firstboot File 66.45 KB 0755
systemd-hwdb File 130.85 KB 0755
systemd-id128 File 66.23 KB 0755
systemd-inhibit File 66.25 KB 0755
systemd-machine-id-setup File 66.34 KB 0755
systemd-mount File 66.45 KB 0755
systemd-notify File 66.23 KB 0755
systemd-path File 66.23 KB 0755
systemd-repart File 194.59 KB 0755
systemd-run File 66.51 KB 0755
systemd-socket-activate File 66.23 KB 0755
systemd-stdio-bridge File 66.23 KB 0755
systemd-sysext File 66.35 KB 0755
systemd-sysusers File 66.59 KB 0755
systemd-tmpfiles File 130.5 KB 0755
systemd-tty-ask-password-agent File 66.23 KB 0755
systemd-umount File 66.45 KB 0755
systemsettings File 194.16 KB 0755
systemsettings5 File 194.16 KB 0755
tabs File 66.09 KB 0755
tac File 131.01 KB 0755
tail File 131.07 KB 0755
tar File 527.24 KB 0755
tasksel File 26.82 KB 0755
taskset File 130.16 KB 0755
tbl File 194.29 KB 0755
tclsh File 66.07 KB 0755
tclsh8.6 File 66.07 KB 0755
tdbbackup File 66.09 KB 0755
tdbbackup.tdbtools File 66.09 KB 0755
tdbdump File 66.09 KB 0755
tdbrestore File 66.09 KB 0755
tdbtool File 66.57 KB 0755
tee File 66.88 KB 0755
tempfile File 66.31 KB 0755
test File 66.84 KB 0755
testparm File 66.13 KB 0755
tgatoppm File 65.8 KB 0755
thinkjettopbm File 65.8 KB 0755
thonny File 945 B 0755
tic File 130.2 KB 0755
tifftopnm File 65.88 KB 0755
timedatectl File 66.23 KB 0755
timeout File 67.42 KB 0755
tjbench File 66.4 KB 0755
tload File 66.17 KB 0755
toe File 66.09 KB 0755
toilet File 22.91 KB 0755
top File 135.34 KB 0755
tor File 3.36 MB 0755
tor-gencert File 481.04 KB 0755
tor-print-ed-signing-cert File 417.02 KB 0755
tor-resolve File 194.07 KB 0755
torify File 1.34 KB 0755
torsocks File 11.42 KB 0755
touch File 131.02 KB 0755
tput File 66.12 KB 0755
tqdm File 207 B 0755
tr File 66.87 KB 0755
tree File 131.66 KB 0755
troff File 815.7 KB 0755
true File 66.78 KB 0755
truncate File 66.85 KB 0755
trust File 258.41 KB 0755
tset File 66.09 KB 0755
tsort File 66.85 KB 0755
tty File 66.81 KB 0755
twolame File 27.05 KB 0755
tzselect File 15 KB 0755
ucf File 40.69 KB 0755
ucfq File 18.91 KB 0755
ucfr File 10.85 KB 0755
uclampset File 130.16 KB 0755
uconv File 66.6 KB 0755
ucs2any File 18.18 KB 0755
udevadm File 1.26 MB 0755
udisksctl File 66.16 KB 0755
ul File 66.16 KB 0755
umax_pp File 195.24 KB 0755
umount File 66.16 KB 4755
uname File 66.81 KB 0755
uncompress File 2.29 KB 0755
undill File 587 B 0755
unexpand File 66.88 KB 0755
unicode_start File 2.71 KB 0755
unicode_stop File 528 B 0755
uniq File 66.91 KB 0755
unix2dos File 54.09 KB 0755
unix2mac File 54.09 KB 0755
unlink File 66.8 KB 0755
unlzma File 130.51 KB 0755
unmkinitramfs File 3.59 KB 0755
unrar File 323.08 KB 0755
unrar-nonfree File 323.08 KB 0755
unshare File 130.38 KB 0755
unxz File 130.51 KB 0755
unzip File 194.95 KB 0755
unzipsfx File 130.76 KB 0755
unzstd File 1.13 MB 0755
update-alternatives File 66.17 KB 0755
update-desktop-database File 22.16 KB 0755
update-mime-database File 59.04 KB 0755
upower File 66.08 KB 0755
uptime File 66.16 KB 0755
usb-devices File 4.35 KB 0755
usbhid-dump File 66.64 KB 0755
usbreset File 66.36 KB 0755
users File 66.85 KB 0755
utmpdump File 66.16 KB 0755
uuid File 66.1 KB 0755
v4l2-compliance File 707.45 KB 0755
v4l2-ctl File 459.84 KB 0755
v4l2-sysfs-path File 66.23 KB 0755
vcgencmd File 66.3 KB 0755
vclog File 66.47 KB 0755
vcmailbox File 66.27 KB 0755
vcut File 66.09 KB 0755
vdir File 195.74 KB 0755
vi File 1.65 MB 0755
view File 1.65 MB 0755
vim.tiny File 1.65 MB 0755
vkcube File 259.17 KB 0755
vkcube-wayland File 259.4 KB 0755
vkcubepp File 323.52 KB 0755
vlc File 66.08 KB 0755
vlc-wrapper File 66.08 KB 0755
vmstat File 66.53 KB 0755
vncagent File 1.02 MB 0755
vncfopshelper File 824.33 KB 0755
vncinitconfig File 52.44 KB 0755
vnclicense File 1016.38 KB 0755
vnclicensewiz File 3.63 MB 0755
vncpamhelper File 720.35 KB 0755
vncpasswd File 648.23 KB 0755
vncserver File 581 B 0755
vncserver-virtual File 1.18 MB 0755
vncserver-virtuald File 3.07 MB 0755
vncserver-x11 File 1.54 MB 4755
vncserver-x11-core File 6.17 MB 0755
vncserver-x11-serviced File 624.28 KB 0755
vncserverui File 4.29 MB 0755
vncviewer File 10.79 MB 0755
vorbiscomment File 66.16 KB 0755
vorbistagedit File 4.32 KB 0755
vsftpdwho File 54 B 0755
vulkaninfo File 643.31 KB 0755
w File 66.19 KB 0755
w3m File 1.6 MB 0755
w3mman File 1.37 KB 0755
wall File 66.16 KB 0755
watch File 66.55 KB 0755
watchgnupg File 66.09 KB 0755
wayfire File 1.19 MB 0755
wayfire-pi File 510 B 0755
wayvnc File 201.99 KB 0755
wayvncctl File 69.46 KB 0755
wbmptopbm File 65.8 KB 0755
wc File 66.99 KB 0755
wcmgr File 65.98 KB 0755
wdctl File 130.19 KB 0755
webalizer File 212.18 KB 0755
webazolver File 212.18 KB 0755
wf-panel-pi File 711.14 KB 0755
wfpanelctl File 697 B 0755
wfrespawn File 135 B 0755
wget File 467.09 KB 0755
whatis File 67.03 KB 0755
whereis File 66.59 KB 0755
which File 946 B 0755
which.debianutils File 946 B 0755
whiptail File 66.65 KB 0755
who File 66.98 KB 0755
whoami File 66.81 KB 0755
winicontopam File 65.8 KB 0755
winicontoppm File 65.8 KB 0755
wireplumber File 66.23 KB 0755
wish File 66.09 KB 0755
wish8.6 File 66.09 KB 0755
wlopm File 66.05 KB 0755
wlr-randr File 66.1 KB 0755
wordview File 8.97 KB 0755
wpa_passphrase File 130.1 KB 0755
wpctl File 66.44 KB 0755
wpexec File 66.3 KB 0755
write File 66.16 KB 0755
wrjpgcom File 66.09 KB 0755
wsrep_sst_backup File 2.39 KB 0755
wsrep_sst_common File 66.86 KB 0755
wsrep_sst_mariabackup File 49.23 KB 0755
wsrep_sst_mysqldump File 8.11 KB 0755
wsrep_sst_rsync File 29.72 KB 0755
wsrep_sst_rsync_wan File 29.72 KB 0755
www-browser File 1.92 MB 0755
x-session-manager File 659 B 0755
x-terminal-emulator File 133.39 KB 0755
x-window-manager File 387.55 KB 0755
x-www-browser File 848 B 0755
xarchiver File 323.19 KB 0755
xargs File 130.27 KB 0755
xauth File 67.37 KB 0755
xbmtopbm File 65.8 KB 0755
xcmsdb File 67.11 KB 0755
xcompmgr File 38.08 KB 0755
xdg-dbus-proxy File 65.93 KB 0755
xdg-desktop-icon File 20.16 KB 0755
xdg-desktop-menu File 42.27 KB 0755
xdg-email File 26.3 KB 0755
xdg-icon-resource File 29.33 KB 0755
xdg-mime File 41.14 KB 0755
xdg-open File 25.46 KB 0755
xdg-screensaver File 37.11 KB 0755
xdg-settings File 37.5 KB 0755
xdg-user-dir File 234 B 0755
xdg-user-dirs-update File 66.01 KB 0755
xfallback.sh File 451 B 0755
xgamma File 66.32 KB 0755
xhost File 66.47 KB 0755
ximtoppm File 65.8 KB 0755
xinit File 18.47 KB 0755
xinput File 55.32 KB 0755
xkbbell File 14.36 KB 0755
xkbcomp File 204.64 KB 0755
xkbevd File 38.66 KB 0755
xkbprint File 82.63 KB 0755
xkbvleds File 23.23 KB 0755
xkbwatch File 19.25 KB 0755
xkeystone File 16.58 KB 0755
xls2csv File 67.27 KB 0755
xml2-config File 1.4 KB 0755
xmlstarlet File 130.03 KB 0755
xmodmap File 66.91 KB 0755
xpmtoppm File 65.84 KB 0755
xrandr File 66.95 KB 0755
xrdb File 66.8 KB 0755
xrefresh File 66.4 KB 0755
xscreensaver File 66.11 KB 0755
xscreensaver-command File 66.09 KB 0755
xscreensaver-demo File 452.78 KB 0755
xscreensaver-settings File 452.78 KB 0755
xsel File 65.93 KB 0755
xset File 66.73 KB 0755
xsetmode File 66.3 KB 0755
xsetpointer File 66.32 KB 0755
xsetroot File 66.48 KB 0755
xsettingsd File 46.38 KB 0755
xstdcmap File 66.91 KB 0755
xsubpp File 5.05 KB 0755
xvidtune File 68.07 KB 0755
xvminitoppm File 65.8 KB 0755
xwayland-xauth File 448 B 0755
xwdtopnm File 65.8 KB 0755
xz File 130.51 KB 0755
xzcat File 130.51 KB 0755
xzcmp File 7.25 KB 0755
xzdiff File 7.25 KB 0755
xzegrep File 10.09 KB 0755
xzfgrep File 10.09 KB 0755
xzgrep File 10.09 KB 0755
xzless File 1.77 KB 0755
xzmore File 2.14 KB 0755
ybmtopbm File 65.8 KB 0755
yelp File 66.01 KB 0755
yes File 66.8 KB 0755
ypdomainname File 66.01 KB 0755
yuvsplittoppm File 65.8 KB 0755
yuvtoppm File 65.8 KB 0755
yuy2topam File 65.8 KB 0755
zcat File 1.94 KB 0755
zcmp File 1.64 KB 0755
zdiff File 6.31 KB 0755
zdump File 66.27 KB 0755
zegrep File 29 B 0755
zeisstopnm File 65.8 KB 0755
zenity File 136.3 KB 0755
zenoty File 66.3 KB 0755
zfgrep File 29 B 0755
zforce File 2.03 KB 0755
zgrep File 7.91 KB 0755
zip File 264.05 KB 0755
zipcloak File 132.28 KB 0755
zipdetails File 68.55 KB 0755
zipgrep File 2.89 KB 0755
zipinfo File 194.95 KB 0755
zipnote File 131.96 KB 0755
zipsplit File 131.98 KB 0755
zless File 2.15 KB 0755
zmore File 1.8 KB 0755
znew File 4.47 KB 0755
zstd File 1.13 MB 0755
zstdcat File 1.13 MB 0755
zstdgrep File 3.78 KB 0755
zstdless File 197 B 0755
zstdmt File 1.13 MB 0755
Filemanager