__  __    __   __  _____      _            _          _____ _          _ _ 
 |  \/  |   \ \ / / |  __ \    (_)          | |        / ____| |        | | |
 | \  / |_ __\ V /  | |__) | __ ___   ____ _| |_ ___  | (___ | |__   ___| | |
 | |\/| | '__|> <   |  ___/ '__| \ \ / / _` | __/ _ \  \___ \| '_ \ / _ \ | |
 | |  | | |_ / . \  | |   | |  | |\ V / (_| | ||  __/  ____) | | | |  __/ | |
 |_|  |_|_(_)_/ \_\ |_|   |_|  |_| \_/ \__,_|\__\___| |_____/|_| |_|\___V 2.1
 if you need WebShell for Seo everyday contact me on Telegram
 Telegram Address : @jackleet
        
        
For_More_Tools: Telegram: @jackleet | Bulk Smtp support mail sender | Business Mail Collector | Mail Bouncer All Mail | Bulk Office Mail Validator | Html Letter private



Upload:

Command:

www-data@216.73.216.198: ~ $
ELF��y@h@8@@@@��$$$��P�P�P�x8(�(�(�PP���  $$���  S�td���  P�td������4	4	Q�tdR�tdP�P�P���GNU�GNU��S���;=�=Ȧ%T�1Y/lib/ld-linux-aarch64.so.1�F
J����	���?|���HJ	�q�� 
	a
�6	hN6	#p	"E�	N
��	i
�P 	�	���z1�P	�	�	R�
���x��
�����o�'	�	�	Y
G��3�	����u�TW����	�	7�)	��n��"��*� T
v

CH
�s��c�U��	���*
��Z
F�@v��f�-�>	������	�9��	
����ZFv!�����A/	
�����#
�p�Y��W:$s���, ���l7
�1
�	�ld	
S
�	�iB��`�	�_ITM_deregisterTMCloneTable__gmon_start___ITM_registerTMCloneTableassuan_pending_lineassuan_set_log_cbassuan_socket_connectassuan_releaseassuan_set_gpg_err_sourceassuan_newassuan_send_dataassuan_transactassuan_read_lineassuan_sendfdassuan_pipe_connectassuan_write_linegcry_xcallocgcry_xreallocgcry_malloc_securegcry_xmallocgcry_create_noncegcry_strdupgcry_check_versiongcry_set_outofcore_handlergcry_md_hash_buffergcry_cipher_algo_namegcry_callocgcry_xstrdupgcry_set_log_handlergcry_reallocgcry_mallocgcry_freegcry_set_fatalerror_handlergcry_controlgpgrt_logvgpg_err_code_to_errnogpgrt_log_buggpgrt_set_strusagegpgrt_argparsergpgrt_asprintfgpg_strerror_gpgrt_log_assertgpgrt_fopengpgrt_log_fatalgpgrt_fflushgpgrt_log_debuggpg_err_code_from_errnogpgrt_inc_errorcountgpgrt_write_sanitized_gpgrt_get_std_streamgpg_err_initgpgrt_vasprintfgpgrt_log_infogpgrt_log_get_prefixgpgrt_loggpgrt_set_alloc_funcgpgrt_set_usage_outfncgpg_strsourcegpgrt_ferrorgpgrt_set_confdirgpgrt_fdopengpgrt_filenogpgrt_accessgpgrt_log_set_prefixgpgrt_snprintfgpgrt_argparsegpgrt_log_set_socket_dir_cbgpgrt_get_errorcountgpgrt_chdirgpgrt_strusagegpgrt_fputcgpgrt_log_stringgpgrt_getcwdgpgrt_fclosegpgrt_setvbufgpgrt_log_printfgpgrt_reallocarraygpgrt_fputsgpgrt_set_fixed_string_mappergpgrt_vfprintfgpgrt_log_errorgpg_err_code_from_syserrorgpgrt_mkdirgpgrt_read_linegpg_err_set_errnowrite_historyrl_readline_namerl_catch_signalsrl_cleanup_after_signalread_historyrl_instreamreadlinerl_free_line_statehistory_truncate_fileclear_historystifle_historyrl_attempted_completion_functionread_history_rangerl_inhibit_completionrl_outstreamadd_historynl_langinfotmpfilestrcpynanosleepstdinchmodiconv_openstrncpysysconfsetsiddcgettext__ctype_toupper_loc__stack_chk_fail__printf_chkfreadgetrlimitsetrlimiticonvsigdescr_np__assert_failsigfillseticonv_closesigactionfcntlclosedirsetuidstrrchrunlinkstrpbrkmemmove__explicit_bzero_chkinitgroupsgetpwuidforkstrlengetppid__ctype_b_locrmdirunsetenvbind_textdomain_codesetinotify_add_watch__vfprintf_chk__isoc23_strtoldup2getpidreadlinkstdoutisatty__sprintf_chk_exitgetpwnambindtextdomain__open_2__fprintf_chkstrcspnpclose__libc_start_maininotify_initexecvsigprocmaskremovestderrctermidmemchrttynamestrncasecmpraise__ctype_tolower_locgetsockname__cxa_finalizeputenvsetlocalestrchrpopenkillreaddirgetenvstpcpymemcmpmemset__isoc23_strtoulrenamewaitpidtcgetattropendirgetuidsigemptysettcsetattrmemcpyfwriteselectstrcmpuname__errno_locationabortpipefstatstrncmpgeteuid__cxa_atexit__stack_chk_guardlibassuan.so.9libgcrypt.so.20libgpg-error.so.0libreadline.so.8libc.so.6ld-linux-aarch64.so.1GLIBC_2.17LIBASSUAN_2.0GPG_ERROR_1.0GCRYPT_1.6GLIBC_2.32GLIBC_2.25GLIBC_2.33GLIBC_2.34GLIBC_2.38	
�
 ���	�
�
 �M�	�
�
  �
 f�^�
������
'���2���=���H����
P��zX��z`�H�h��p��x�а�����P�������@���H���P�������X���`���p�����������������ȼ(�ؼ8���H��X��`�0�h�H�x�0���8���P���8���X���`���h���p���x������������������������������� ���P� `��U�@[��	��� �X8ШH�X�h�x��p�����������0����H�`�p�(x�8��H��X��h�x�� ��0�����X�����������p���p�(��8ȪH�Xp�h�xp����p����p�� ��p��(��p�(��8p�H��Xp�h��xp����p����@�H�X� h�%p�-x�/��T��Z��l��v��y����������������������������	��
���
��������� �(�0�8�@�H�P�X�`�h�!p�"x�#��$��%��&��'��(��)��*��+��,�.�0�1�2�3�4��5�6�7�8�9 �:(�;0�<8�=@�>H�?P�@X�A`�Bh�Cp�Dx�E��F��G��H��I��J��K��L��M��N�O�P�Q�R�S�U��V�W�X�Y�[ �\(�]0�^8�_@�`H�aP�bX�c`�dh�ep�fx�g��h��i��j��k��m��n��o��p��q�r�s�t�u�v�w��x�z�{�|�} �~(�0��8��@��H��P��X��`��h��p��x���������������������������������������������������� ��(��0��8��@��H��P��X��`��h��p��x���������������������������������������������������� ��(��0��8��@��H��P��X��`��h��p��x���������������������������������������������������� ��(��0��?#�{�������{���#�_�_$��{����FD�""� � � �_$���JD�B"� � �_$���ND�b"� � �_$���RD��"� � �_$���VD��"� � �_$���ZD��"� � �_$���^D��"� � �_$���bD�#� � �_$���fD�"#� � �_$���jD�B#� � �_$���nD�b#� � �_$���rD��#� � �_$���vD��#� � �_$���zD��#� � �_$���~D��#� � �_$����D�$� � �_$����D�"$� � �_$����D�B$� � �_$����D�b$� � �_$����D��$� � �_$����D��$� � �_$����D��$� � �_$����D��$� � �_$����D�%� � �_$����D�"%� � �_$����D�B%� � �_$����D�b%� � �_$����D��%� � �_$����D��%� � �_$����D��%� � �_$����D��%� � �_$����D�&� � �_$����D�"&� � �_$����D�B&� � �_$����D�b&� � �_$����D��&� � �_$����D��&� � �_$����D��&� � �_$����D��&� � �_$����D�'� � �_$����D�"'� � �_$����D�B'� � �_$����D�b'� � �_$����D��'� � �_$����D��'� � �_$����D��'� � �_$����D��'� � �_$���E�(� � �_$���E�"(� � �_$���
E�B(� � �_$���E�b(� � �_$���E��(� � �_$���E��(� � �_$���E��(� � �_$���E��(� � �_$���"E�)� � �_$���&E�")� � �_$���*E�B)� � �_$���.E�b)� � �_$���2E��)� � �_$���6E��)� � �_$���:E��)� � �_$���>E��)� � �_$���BE�*� � �_$���FE�"*� � �_$���JE�B*� � �_$���NE�b*� � �_$���RE��*� � �_$���VE��*� � �_$���ZE��*� � �_$���^E��*� � �_$���bE�+� � �_$���fE�"+� � �_$���jE�B+� � �_$���nE�b+� � �_$���rE��+� � �_$���vE��+� � �_$���zE��+� � �_$���~E��+� � �_$����E�,� � �_$����E�",� � �_$����E�B,� � �_$����E�b,� � �_$����E��,� � �_$����E��,� � �_$����E��,� � �_$����E��,� � �_$����E�-� � �_$����E�"-� � �_$����E�B-� � �_$����E�b-� � �_$����E��-� � �_$����E��-� � �_$����E��-� � �_$����E��-� � �_$����E�.� � �_$����E�".� � �_$����E�B.� � �_$����E�b.� � �_$����E��.� � �_$����E��.� � �_$����E��.� � �_$����E��.� � �_$����E�/� � �_$����E�"/� � �_$����E�B/� � �_$����E�b/� � �_$����E��/� � �_$����E��/� � �_$����E��/� � �_$����E��/� � �_$���F�0� � �_$���F�"0� � �_$���
F�B0� � �_$���F�b0� � �_$���F��0� � �_$���F��0� � �_$���F��0� � �_$���F��0� � �_$���"F�1� � �_$���&F�"1� � �_$���*F�B1� � �_$���.F�b1� � �_$���2F��1� � �_$���6F��1� � �_$���:F��1� � �_$���>F��1� � �_$���BF�2� � �_$���FF�"2� � �_$���JF�B2� � �_$���NF�b2� � �_$���RF��2� � �_$���VF��2� � �_$���ZF��2� � �_$���^F��2� � �_$���bF�3� � �_$���fF�"3� � �_$���jF�B3� � �_$���nF�b3� � �_$���rF��3� � �_$���vF��3� � �_$���zF��3� � �_$���~F��3� � �_$����F�4� � �_$����F�"4� � �_$����F�B4� � �_$����F�b4� � �_$����F��4� � �_$����F��4� � �_$����F��4� � �_$����F��4� � �_$����F�5� � �_$����F�"5� � �_$����F�B5� � �_$����F�b5� � �_$����F��5� � �_$����F��5� � �_$����F��5� � �_$����F��5� � �_$����F�6� � �_$����F�"6� � �_$����F�B6� � �_$����F�b6� � �_$����F��6� � �_$����F��6� � �_$����F��6� � �_$����F��6� � �_$����F�7� � �_$����F�"7� � �_$����F�B7� � �_$����F�b7� � �_$����F��7� � �_$����F��7� � �_$����F��7� � �_$����F��7� � �_$���G�8� � �_$���G�"8� � �_$���
G�B8� � �_$���G�b8� � �_$���G��8� � �_$���G��8� � �_$���G��8� � �_$���G��8� � �_$���"G�9� � �_$���&G�"9� � �_$���*G�B9� � �_$���.G�b9� � �_$���2G��9� � �_$���6G��9� � �_$���:G��9� � �_$���>G��9� � �_$���BG�:� � �_$���FG�":� � �_$���JG�B:� � �_$���NG�b:� � �_$���RG��:� � �_$���VG��:� � �_$���ZG��:� � �_$���^G��:� � �_$���bG�;� � �_$���fG�";� � �_$���jG�B;� � �_$���nG�b;� � �_$���rG��;� � �_$���vG��;� � �_$���zG��;� � �_$���~G��;� � �_$����G�<� � �_$����G�"<� � �_$����G�B<� � �_$����G�b<� � �_$����G��<� � �_$����G��<� � �_$����G��<� � �?#�{�����S��[��c��k��s��C����B�G��3��o���������@@��g��ҷ���r �����?��,�������/�!@�R0���W������R���R�������Ro5�`b���4`�!�R�"�����d��c�������#���4��@�q�RT�q�T�Q0qIT`b����q@QTTPq`PT�MTq�"TLq�PT`b��w@�(���Z`xa � ���q�OT�q` T�q�NT?`b�4������������`b�HB����R\ �`f5�RA�����5+&���@�R����$��� �R���ab� �R4 �!@�?q�ן�7���5���G�@�@5tb��"��B@��J5ab���@�!@�*�5�o@�_q-T����_k�T�3@��~}�hv�@9?�q��T@9�q���T��R����!`0������3@�!hv�����o@�����G�@�����L����*`F5tb��o@��"��Z@�A4�4�&@�����R����!2��&�~�������B�1�!�2������Z@�4cb�c �w(@�W���R����!2�(�m�������B�1�!�2������3@�q���cb�c �`(@���`$@�����R����!2�(�W�������B�2�!�2����������!@.�]�������vb��"��Z@��>5�&@��D�������5�&@��R�C@��^@�c�����5�
@�@r5�����C@�	��� 5U��@������T�ҡ���!`=��=����9�R������O���7�~��c���6���|Ӏkt����G@�����kt� �?������G�����*�kt�@@�`2��k4��Rq�TATU'�����`b�@�`M5�� � � �O���6��@���5>�4���c��C��#������*9�Rq��T�@���R������?���@��������n����+��������#@���h������
�&��ab� @� ���`b�!�R`����C@�����Ry
��*`�4��!�:���R��������*��������E����`b�t@���4�R�����B�R�җ������G���B�R��@�p������$�`b�!�Rp�����$�`b�!�RH�����$�`b�!�RD�����$�`b������$�`b��w@�H�����$�`b�!�R@�����$�`b�d@�!xd�����$�`b�!�R<�����$�`b�!�R8�����$��w@��Ҙ�ab� �y���$��w@��ґ�ab� �r���$��w@��Ҋ�ab� �k���$��w@�#�g���G@�Q������n������jaT�4��R����f���G@�D����������O@��+��G@�t|@����R��������@����! ?���R��J�������G@������ht8(qaT�h48�G@�`b�l@�`!5�1T��@��|@�`�$��|� h`��,5�@9�q�7T`b�@�q�@�a(T`b�h@�`4���
��������C@�/����*�����t_5�G@��@9�q@z@T�C@�����b��! "������@�5�@9�q�T!@��!��!$��!6�q��Iz�T�@8�qIz���T����!@"�������� 5�@�#@��#��@9�qc$��ct0��*��������* G5�@�`4�����=�o����������� � � �O��Rq��T�Ё��c� �!;��;���R$����O���7�5 � �sb�`
@��4`B@�`5bF@�����/�!`/�_q!����`"�D��������-� @5�������G@��������G��gB�@�B���a�T�C��R�SA��[B��cC��kD��sE��{ƨ�#�_��G@��������@=�{,����G������O@��*q T?� ��T��7��4�R?����!`=���R�ґ�������@������������ �R�����H������*e���qaT`b�!�R�z������!<�����3������5 @9�3@�x��4$q`�T�� <����`b��w@�,�f���w@�d��@�R���a��`b�!�Rt�]��x"�����! 0����&�������G�@�V������q����@�R��������*������������b5�3@������^@��C@��A@�������s�����5�
@����4�3@����4�!@���������@9�qIza�T�� @8�qIz���T?��T�4�8 @8���5�9�G@���*@��/��Ҁ�@6������U����\5�*@��R�C@��R���� �5�
@�5�������������G@���@�/����G������*�O@�?� �T�O�q+�T��T�R��!�>���R�����~����O�����@9q��������T�O���5����u����G@����`b�p@���5�!��ҁ�!�<����>�R���,���4l���<�����������<�U���-����!�/������'��[����@������G@���������3����'@����C����@�f|�!<���������+��hf���h&�2����@����D��[@��hf� 5�@9?�q�T @�� ��$��@6�Q�h&���c|��hc� ��5�@��*h#�i������������`>��������������!�?����K�������K@��@��E����5�@9?�qh��T @�� ��$���6�Ҕ`|��h ���q��T`�T�R"�������5�����e���@9�����5�@8�4�qIz���T��8���@9�qIz�T � Հ@8�qIz���T����!�����4����! �
���@"4����!@�����"4����!�����@4����!�������4����!������%4����!@���'4����! ���`,4����!���� *4����!�����14����!����64����! ����`84����!����`64����! �����k4����!@�����h4����!�$����c4����!�������a4����!�������`4����!������_4����! ������^4����!`������]4����!�������S4����!������`P4����!`������L4����!	������F4����! 	����� 94����!@
��������4����!`
����� ��4����!�
������64����!�
�~��� 55����!�
�y���45�R��q+���O���<�����������"�8��������!�:���R�Ұ������*��������,���������&@����5�&���k��{2����N���@)�:@�?q�� 
5�>@�`5�@�������*�*���������RI/��*��2�T4`b� �@�!L58@��>�
5<@�`4?�qAKT���R!�8���z��������R�����@��������R�RH/��*�`b�h@�`
4��$����	��R�R����J�������S@������C�&�����R��x��`b�h@�4��������R!�R����4���k���@��������R�R0/��*�����!�R��^�����R!�R��Y��t�A���`������@����B��� �R�����@����?pq�@T���R!�7���&��������!�!���R�� ������*������������I�����R�R��4��`b�h@��4������ �"�R�R�����'��?4q<T�Т�R!@9���������|b��GB�@� �R\������GB��@T���`b�D�`b�h@� 5�ҁ���!�������
4�@9@5���������"�R�Rd���tb�@�����BB�����B��BB�@���������`b���!@��R@B�t��@����@��5�@���Rq���b� �R��Q����@��R�@����R���`b����B��!@�@B������@�`��@�����@��5�@��R��R�qc��b� �R���'�4����@��@��'@��`b�h@��4��V����$������ �R����ab� D������R���I���������������������!������ab� D� ����@�������������������`b�h@�`4��-��������C@�&���S������`b�h@��4�� ���@�����H�����`b�h@��4�����`���@������;���r���C@����n����@����j������g����R����!1�B�����!�1���� �RY�������@�`��������� 3����� �RO�����������3����� �RH����&@����������5����� �R?������
�����?������!������5��������6�� �R��3����7�~@������+�|����ja�2������@���@ha��	5�����������!
����'�k��5�'@���������+@����#��c�`|�Bh`�"h �����R����!@!�����o������@���! 
�R���4�@��R��c������'@��������������@��#����+@���|�@����'������@��'@�\h!�@ha�����@�"@����Qb�`�_|�h!���ja������@����O��j!�����ja��������-�����@��j!������@	�4������Fq�T������#�|@��C�!��c��@���������_h!��h!��h!���������O����@�����w���������"�R��h4��@�h4���������������Fql��T������#�|@��C�'����@�t|��c�&�҃���_h4��h4��h4�f�������&�� h4��k4������?$q�T�@9"xb��5A48@9�qIz T@5u���@�������*���q��`b�h�n������!@.�Z������`b�@��l�4���������`���������j����Z������@���[��������� 3���O��@�RI����@�P������� 7�������!�9���R��!������*��������� �R5��������4��� �R.�*@���������6��� �R%�4���?`b�4�$��`b�<�!��`b�!�R<���`b�8���`b�!�R8����C@�������R$�������<�������������B�����*"������!�2��3�7$����ҥ$����3@�q@�!T�*������������W������tb�����!����c��`\�T�zc����4�* �R���'�L����@��'@��`b�h@��4��o���`���������B�R�ҋ���bb���`�@@��4!|@���`�#������������ � � � �_$��������@��#������G�����������G�@����_� � � � � � �� ���! �?�T��!�G�a����_�� ���! �!�"��A��!�A�����B�G�b����_�?#�{��������`BO9@7���G�����@������ �R`B9�@��{¨�#�_� �_$��� � � � � � �_$�Q�q�T�$���_֡�!��!H`8`�!� ֟$ՁТ�R!����6���$Հ����_֟$Հ��)��_֟$ՁТ�R!`���(���$�>�$Հ����_֟$ՁТ�R!�������$Հ����_֟$Հ����_֟$Հ�@��_֟$Հ����_� � � �?#�{�����S����*@9�
4����B�4���*C@9���q!��T5���b@9b4����Rd@9c�_�q T_�q$@zB�b�8�*s���59�SA��{¨�#�_�A@95B����4f
@9�5s�b�8�*�b�89�SA��{¨�#�_�C@9B�����q	T��Q�\Q�q�SDS�����qhT�Q��s
�b@9d�8���S��q�T�\Q��Q�qB�B������� �Ҹ�� � �?#�{�����[������S�����A���s@�3���`B�O���`��5`@�~���u�������`��SA��[B��{è�#�_�����`�V�����@�����A������a��?#�{�����S������[��*�*@9�5c@8�4�qdIz���T8`@9�qIz�Tc@8�qdIz���T��Z���.�����`�����@9uZ)�q�T��~������ @�3���SA��[B��{è�#�_ց@9�ҁ��4�?#�{�����S������[���"@9�5Wb@8�4_�qDIz���T8b@9_�qDIz�T � �b@8_�qDIz���T�4b@9��"5����6����������������* �C� 5���*]�5�@����SA��[B��{Ĩ�#���b@8"��4_�qDIz���T9�������������[���@�+����[B��������SA����{Ĩ�#Ճ�������*��!�}�@����SA��[B��{Ĩ�#��������*��` �p�����sB.���� � � �?#�{����6"��{���#��R�_�?#�{�������S���3�A���s@�S���`B���`��5`@��SA��{¨�#�_���/���@��������SA��{¨�#��� � � �?#�{��B�R���9��q�T�S����b��������`�4�*���3��SA��{¨�#�_��SA����{¨�#��!�%��{¨�#Հ��!� �?#���{�����[������G��S����3��@9@����ҁ5��@8�4?�q$Iz���T�8�@9�qdIz�T�@8�qdIz���T���5pc@8�4�qdIz���T8a@9?�q$IzT � � �a@8?�q$Iz���T�4a@9���5����n��������*�q(T��!`�"��#�RC� � @�`5�*��B`"�a�����������������G��@�@�B��ҡT�{C����SD��[E��3@�����#��@8���4?�q$Iz���T9����?��@�������@�P�����!�G��@�"@�����T�{C����[E����SD����3@�������#՟����*�"����1`��T�*A��������*��` �������sB.����/� � �?#��Ѣ�B�G��{�����[����b��S���axD�@@�����?�qlT�c�!��`h@�ax�5�@9�����2��*�5Za@8�
4?�q$Iz���Tx��`T#�T'��T+�!T�T�T���*�(����`@9s��qIz�T`@8�qIz���T@4�����RD�a@9���5!a@8�C4?�q$Iz���T`@9��q@MT �`C4�qIz�Ta@8?�q$Iz���TaB4�����R*�a@9�5a@8�4?�q$Iz���T��q�:T�T��q�9T�2T��q8T��qA8T ����4��`@9��������@������b���m�zD�!Q�z��cF���!�G��@�"@����ET�{C����SD��[E�����#�_֟���2������'�����������N�|������y������!�&�����4����!�'������4�����*�)�����������!�'������4����!(�������5�R��`����<@`"���������@9�q!��T�@9�q���T�
@9�qa��T`@9�qIzT � � �`@8�qIz���T����!�#���"4����!�#���,4����!�#��� 14����!$���14����! $���`14����!@$���`44����!�$���`54����!�$���35����`"�!@�x���o������#�z�q������!'���j��4����! (���d�4����!`(���^�@�5�R��`�a��������*��C��������(�P���G������!@'���G�`�5`�!�R������<��`���!�'����6��`��R������1��`���!�'����@9@�4��b�R�qAT"9 @8���5"�����R`�+�����`"�!xS �������q�T��qT��qT��`@9�a@9w��%4 ��'��������҇��� � � ���?pq�T�@8A'4��B�?pqa��T�@9��4�@9��?�q(T?lq�	T"pQ!š_�T?�q!T4�@9�4a�Q!?�qHT�����a$���6A�Q!?�qHT�����A$���6�,@8!4�������,@8�5$���d@94a
@9�pqT8��A4�*�@9�pqA��T�4�
@9?�q�T�T?pq�T�T?�q`T?�qT8�
��4�@9���?�q@THT?�q�T?�q�T!�R8�
�d��59���?�q`��T?�q ��T���4�@9B�QB_q��T!�Q!?q���Ta�Q!?q��T�������?�q@T?�qT��R8�
����59������ ��[�@�+����� /���y����q�T�~�`@9K��?�qT���4�@9�4��QB_�qhT�����$š�6#�Qc�qhT�$Ú%6��qhTBS?�q�T#\Q$�Q?qc�c����B8�L@8���4�@9������`@9���!���*����)�T�D����@�`@9�������`@9����`@9�����������`@9
����4�@9�
�e��������+���R8�
���59%��a�R8�
���59����R8�
�$�59��A�R8�
�d�59����qaT�����������a��B�)��������������������������.���,����������D�4�@9B�QB_q��T!�Q#q���T��Q�q��T���A8dL@8��4�@9���� �����������������$��������%������~������\Q��Q�qBS�SB��i���c�w�@����������?#�{�����[��c���@9�4���2��s������S��k�����Rh����@9?�q�
T?�q T������5Ua@8�	4"x_�q$Iza��T{@9;	49�@9A4D�������{9�����a���?�bT����������� �����������������`�|�������m������������@9��5�SA��kD��sE����[B��cC��{ƨ�#�_�@9����4���R��q�Tt@8��4��qa��T!���!q%��T{@9�q`T��;��5���������������������������@��T���������������{9������������B������9��������t8����Ҿ������?#�{�����S�����@9�5Ib@8�4_�qDIz���T8b@9_�qDIz�T � �b@8_�qDIz���T4��@D��4�[���5�����X�⬌R����r��D�������������g����������b����[B��SA��{è�#�\�"4���[����)��������R���������������[B������SA��{è�#յ�������SA��{è�#կ����}���������������5������s���������?#�{�����S��[��C�������G���!@9@����ҁ5a@8�4?�q$Iz���Tb@9_�qDIz�Tb@8_�qDIz���T���5"@8�4_�qDIz���T?9��b�@B���'����#�@�������@4@�X����@����@���@�������@��
5@�c��4����!@.�n���@��b� @� 
5�#�|@�����%� 
5�������!�������5����
5@��5@�4���q���������5�#B� �R�'B���!�G��B�"@�c��ҡT�C��SA��[B��{Ĩ�#�_�����!�,����� ��b� @����4������ -�K���������������`��4������+�>���c�������@������������*����T5�Һ��������+�)���_�@��4��@���������.�����������,������*o������@+������#B��'B��b� @�@5�R���������!�2����*������`*����R�����@����������,����#B��R�'B������@����������+����#B��R�'B�~���#��'���?#�C����{��������B�G��S���[	��b��*�c
��������k�����9�G�@@��7���������������5�5�
@�q
T�@�@@9�q�T�@���#���q�
T�@�`4�FB��� �R���FB�?�T!@�@�R���@���� �R��!�G��7@�"@�c����:T�{G��SH��[I��cJ��kK��C��#�_�#@����@�"��b�!@�@�R���@�@@9�q���T���@���C@9Lq T?�T<q�T?� ��Tq!TC@9Hq�T8qA��TC@9q�TC@9��Rja��T�FB��� �RG��FB�?�T�C�"��#@�6�!@�@�Ru������@@9�qA��T��sb�dFB���`:@�s"��#5`6@�`5��s�G���"��c@��a@�@�R^����B@9_,qA�TC@9��Rj��T��sb�bFB��� �R�aFB�?�@T�C�"�ҳ�s�G�c@��a@�@�RD���B`"����Ra���������� /������R���C@9��Rja�T��sb�bFB��� �R��aFB�?��T�C�"�ҳ�s�G�c@���a@�@�R!���G��?��T$qa�T@@98q�T@@9Dq��T@@9TqA�T@@9$q��T@@9Hq��T@@9q!�TA@9��R?j��T��sb�`FB��� �R��aFB�?�@T��s�G�"���C�c@���a@�@�R���@������`�5����!@/�]�����Z����T�s�\�R	����@��Z��<�iTdFB�@@9�q���T��"�i��TA@9?�q�T!�Q lSA@9?�q�T!�Q�*�����@��Z�Z��<��T�sL��@@9Hq��TA@9��R?j!�TB�R��@�������q��c�Za�҂�B`"�X�����sb��� /�d���`FB��� �Rj�aFB�?�@T��s�G�"���C�c@�W�a@�@�R���@� �R ��R��?q#�Q!\Q!����� \Q#�Q?qlSalS�����Z��T��s�G��s���"�R`/�[�R���5\@9��q@T�+q��a@��*��{Z�n��@��@��;�(��T�+q�����sL�����@�a�R�!��T@@9�q(T�QlS@@9�q�
T�Q�Z��*��c@�B���@�!������i�T��s�G����.�Z��s�����.���@������BKQ�.��R �R0��@��@� �R�@�{Bh|8��'�Cq�T#q�T�@��h��Tc@�b���@�!��{����Cqa��Tc@�b���@�!�����@��@�h|8��87C��@�@���hcx@p6@6����R�����`T�@�{@���T���R������Ta@�@�RZC����@�@������@���T�sL���a@��R�������*����q�Q\Q�����\Q�Qq�oS@lS������ �R�����s�k� � � � � � �_$բ�B�G���!�G�@�?��_�_$ա�!�G� ��_� � � �_$գ�c�G�$�R�Х�G���B�G�`���!�G���_�$��_� �?#�{�����S��*���4b�7����5�4�*��z�5�R�SA��{¨�#�_�������S4�*�RW�`5qM��T�*�������������@��4��������4��� � � �?#�{�������{���#�� �_$ե���G�?#�{�������G����?����c�B�=�����!=�>�x����G����{���#�!�,���_� � � � � �?#�{��a�!�2�����R��s�����s-�����=����@��{¨�#�R�?#�{������S����-������������-�! -�����`����SA��{¨�#�_��R�� �����������x��_$���?#�{������������-������@��{¨�#�g��_�?#�{�����S����������R����s���������-�����S����SA��{¨�#�_�?#�{�����[����	��c����S���;D���s@�3���`B�
�`��5b@���B@��C@���TV@�����/�v
����SA��cC��[B��{Ũ�#�_��Ҡ�R��������@�����R�����#����9-���������R����)�������R��������������"���a@�T��#@��`����SA��cC��������R�[B���{Ũ�#�����`��������@�s�;D�`~�;����������R�SA���cC��[B��{Ũ�#����SA��cC����#@���� � � � � � �?#�{������P�a��!�2��{���#� ���_�?#�{�����[����S����*�c��s���@9!4������4���R���?�qHT'��6s���jc8a4��?�q	��T[��������������jc8�5�|@��5�����
��@9�4�R��R7�R�k�y�R�q�T*q�T[��*������`~S�
$qs�\��48���e�&qs^��:8s����!8�@8�4���4���:��qA��T�
��48��:8��� 8�@8���5�kD���4��9�SA��cC��sE����[B��{ƨ�#�_�E��@9����5����
�9B�R9���R��!8���
�9�R9���!8���*�9�� ��u��4��SA��cC��sE�����?#�{�����S����[��*�c����� �3�� � � �����s���`����
�����}���T��4���b
T<���@
�������"�#��ҟ�9��z9���������9��4a@9?�q$Iz�Ta@8?�q$Iz���T���Ta��8���Td@9��q�Iz@��T�59�}�� C��j9�?��!T�#@����SA��[B��cC��{Ũ�#�_�`@9�qIzT � � �`@8�qIz���T�����`��T��8���T@9?�q$Iz@��T����R�������SA��[B��cC��{Ũ�#�_�������D�����Ё���c!�!@-��-�b��R���@9�q@T�Q�$q�T�R�@8���Q�$qI��T$�D�7�@9�q�T�@9����q�T��Q�?$qHT�R �@8!���Q��$qI��TA���7@9?�q�T��_�@9�R�Q$q��T��_�@9!�Q!?$qI��T�R�?���_��@9���q T��Q@$q�T���R@8!A��QD�$qI��Ta�!��7�_�@9�Q$qi��T�R�����_� �?#��{�����S�����B�G��[��*���c����c��k������s��c�A@�����w@�P��|j@���7�?���|�}�S@��������"�C����a��T�@��#5��R��Ҡ��G��@�@�B��ҡ#T�{R����SS��[T��cU��kV��sW����#�_��"q�T���?��*��}��S@���S��� @9�q�
T�@�@4�����������������@�3���RA���s�8������_���q�T@9�q���T@9@��5s����������_�a���v�6@9�q��T���@����������@����
��4����b@9_�qaT`@9�4��������R8��Q��������������Tтja8_�q�
T�����B�7��*�� @9�q@z@T�@� ��4��������R��`
�9������k����@�@�A4��������t���Z@�����`�|���������!�������������@� �5 ����Ң�����`���.����@�@9!5�@�`5������@
�:���'���`���E��#�����l�t�����y������@�Z@�����}���`���]�k���@���4=�:����������8��������_8�q��T���j!8������@��5��B�����O����������@�@�A4v���`�@9��A��4@�`�������`�@9���47���������"�������G�@���@�Y�����B/�!�R����@�RG��Є!��@�����B@-�!`.��=�R��R����K�?#�{�����S�������������������5ajt8`�?�qT"@��"��B$���6?�q$IzAT@8?�q$Iz���T�SA��{¨�#�_����SA��{¨�#�_�_$�	�?#�{�����S�����������s�����@�`@8�x`��@8�x`��k�T � � ����s����@8�x`��k!��T�����
� T��g@9d�(@9j�!��~��xh��hb�?k���T��5���@��SA��{è�#�_�@����SA��{è�#�_�g@9G��5��@9�SA�q����@��{è�#�_���_�_$������@8d�Qlx�dq������	�����)��@8e�Qdx�hq�0��k���T�
��������@T���@9���@9��*�Q%x_iqj�Q�0�ex_iq�0��k��T�5�_��@9���5�����_�A@9?q���_�_$�����j@8g�������'у@8
k!��T�������?�@T�	�(@9i�f@9!�k��Tf��5�_�f@9��5�����_�A@9?q���_� �_$�����D����TC8���T#@9!�C��5_9�_�_�?#�{����������A�D����TC8���T#@9!�C��5_9�{¨�#�_� �?#�{�����S���@9�4��@���S@8�4s�ahsx��o7A@9�9a4����A@8����a8!4@�!ӡhax�o7A@8��a8!��5D��9���SA��{¨�#�_֟9���_$�@9�����#��4?�q�Ta$���6A@8a��59�_�A@99���4�������%���$��6A@8����a8�4?�q	��TA@8��a8a��5D����9�_�?#�{�����S���@9S4��@�����_�B��3@8�4sӃhsxC�o73@8��s��5B�_9���SA��{¨�#�_� �_$ա4?#�{�����S�����[���@!��c����*s���`Ta@9�����������s������T�*t��K�9�SA��[B��cC��{Ĩ�#�_��R�_�_$�4?#�{�����S�����[�u�@!���/��c����*s���`Ta@9�����������s������T�*t��K�9�SA��[B��cC��{Ĩ�#�_��R�_�_$Ձ�?#�{�����S�����[������c����s���`Ta@9�����������s�����T�˟����SA��[B��cC��{Ĩ�#�_���_�_$ա�?#�{�����S�����[�u����/��c����s���`Ta@9��_��������s�����T�˟����SA��[B��cC��{Ĩ�#�_���_�?#�{����R������V����@���{¨�#�4����@��{¨�#�/�?#�{����R���S���D���`s~@�|@�������������j38�SA��{¨�#�_��SA�`�{¨�#��/�� �?#�������)�G����{��C����� �R���
�����������������#@��'����������+)���<���<��Y�����!�G��'@�"@�c��ҡT�{E�����#�_���?#�������)�G����{��C������R���
�����������������#@��'����������+)���<���<��-�����!�G��'@�"@�c��ҡT�{E�����#�_ֽ�?#�������)�G����{��C�����`�R���
�����������������#@��'����������+)���<���<�������!�G��'@�"@�c��ҡT�{E�����#�_֑�?#�������)�G����{��C�����@�R���
�����������������#@��'����������+)���<���<�������!�G��'@�"@�c��ҡT�{E�����#�_�e�_$���_$�@9��?�q$Iz�TA@8?�q$Iz���T#�Q`$q��(TA@8d|@��#�Qa��?$q)��T�_�_$�@9A�Q#!lS$qiTAQ!?q�TA�Q!?qTB\QAlS@9�QC$q	TQB_q�T�Q�_�@�_�B�Q@9AlS�QC$q(��T����QB_q�T\Q�_���_�_$���A4@94��q@T�?1�T!qTC@8d�4�q�T!qA��T�_���A@8#q���5�_���_�_$�Qdq��_� � � �_$��Qdq��_� � � �_$��Qx_hq 0��_� � �_$�Q2_hq 0��_� � �_$�@9A4��"Q!2B_dqHTa9a@8!��5�_� � � �_$�@9A4��"�Q!xB_dqHTa9a@8!��5�_� � � �_$��T@9�5#_k�Tiq�0��hq�0��k�T@8C4��"@9h�Qex&�G�QDx�5�iq`x0��hqAx!0�K�_�"@9�RG�Q��5�_��R�_�"@9�RG�Q"��5�_� � � �_$�_�A��T���2�dq�Tc2b��k!T#he8��he8B�f2���QgQ�eq�T�hq�0�?�@T�5�K�_ւ����K����R�_�_$��Tb���hc8$hc8c���Q�x��Q�x�k�T?iq�0�iq�0��k�T_���T�R�_�K�_� � �_$���T@9�5@8�4��#@9$�q`Bz ��T@_k�#K��_�#@9@_k�#K�����R�_�#@9� � � �_$��������������Tk�K��T?#�{����J�
�#T�
�����`��5�{���#��
��_�_�{���#���_�_�?#�{�����S���@934����@�s~�Bhs�"93@8s��5���SA��{¨�#�_�_$��?#�{�����[����c������S����js8ks8�k T��@��~Ӄ~Ӥhd��hc��kaTs���A��T�SA��R�[B��cC��{Ĩ�#�_րK�SA��[B��cC��{Ĩ�#�_��R�_� �_$�"�R��_$��R��� � �?#���{��C��S�����!�G��[��c��C����k��#�"@�������v@�tf@����� � ��7�>����}�@@�`���q�s"�����T��RI��� Հ��G���@�@�B���AT�{Y����SZ��[[��c\��k]�����#�_�"qmT���*�>�4�}�@@�`�������Y��� ��� � ���C��@�������"�6��*��t�?#��ш��G��{��C�����������������@��'��� ����������������)���<���<��=��=������!�G��'@�"@�c���!T�{E�����#�_�`��2����E�?#��ш��G��{��C�����������������@��'���@����������������)���<���<��=��=b��� ���!�G��'@�"@�c���!T�{E�����#�_�`��2����<�@���!�G�#@�XqT`����`0�!��5�@�R��`Т��!���/�.����?#�{�����S�4�*�[���U�c�����@�3�R�*��*s��`����
|@��ҩ��������*������ ��"�S�� � � �59{3��*������s����V������SA��[B��cC��{Ĩ�#�_�@���� �R� � �_$�"�R?��_$��R<�� � �?#�{�����S��[��*��@9_�q�T@8�q���T�*6 є�3���@T�z3��R�*������8!@9?�q�T � � �@8?�q���Ts����5�*�@��SA��[B��{Ĩ�#�_�*�*�@��SA��[B��{Ĩ�#�_�?#�{�������S��*3��[���5 є���	�z3�������s�8@9�4�*��A�R��T�*�*�@��SA��[B��{Ĩ�#�_� � �?#�������B�G��{����A@�������#�����[�����@������S��C��3�S���`��@��@�Ck�T1�ԀZ��!�G��@�"@�c����T�{B�����#�_��@��@�Ck�T�@��@�Cka��T�������*���5 ��R��R�(� � � �?#�{�����S��*�c��k��*���� ����[�uе�0��s����R�R��W�R � � �����&�'k`8"��(q`T@��*4`@9�4����q@T��1�Tcq`T�@8�4q�TcqA��T � � ��*_klTaK`K�kDK#tSxS`���q!DzkTg@9��4��78@@9�q`T������'k`8��"��R�R��(q�TY�6�R���R�Һ������@8q���5��g4@@9Y��q�T @8�q���T�*�����@@9�qAT@���@8_�q���T����v�������T������o���4w�C �����-���s��`Ta@9�����������s�����TT��965@9�4��T���k`8?(q�T�[B��sE����SA��cC��kD��{ƨ�#�_��R���S���k 8�[B��sE��?#�{�����c����k�����@��S���@94���[�������+�����Rf���@�@9�q�T�q�	T���35c�qHT�&Ú6�@8�4cQ�q�T�qH��T�@9���9?֓9��{���
�������#T������S�������T�������������`@9`��5�SA��[B��+@����cC��kD��{ƨ�#�_������a� ��������Z�������������������s�����R����������@9����4���R��q�T�@8��4��qa��T���q%��T�@9�q�TA����������������B����������9?֕8����������SA��[B��+@��Ҹ�����SA����_$�����!�e�� � �?#�{�����S����>D�3� �`@�s@�?ր>D����>�S����SA��{¨�#�_�?#�{��������Q?qhTqS�@T@�R�������@��{¨�#ս�@T@�R���@��{¨�#����@���{¨�#�_�?#�{���������S����>D�����!@�!�"@�_��T�@��SA��{è�#�_��Җ�� ����>�L��@��SA��{è�#�_�_$�_�_$��*?#�{�������"��6��S��1���s��$�s�0��������7����G�^���R�� �R��@�R���07�1����G����SA��{¨�#Հ��G���a�!1���R*����������a�����!�1������G�?#�{������@���<qsSs*`��@��{¨�#�_�?#�{�����S��*��"�R����|��q`@z�T�@��SA��{è�#�_ր��G�@���<qsSs*`��������@����SA�`��{è�#��1�l� �_$�_�?#�р�R��B�G��{�������#���C@�����U�@4������R�����4%��� �Ra@�!XQ?xr�T��!�G��@�"@�c���T�@��{B����#�_������Ra���!�2�����`@����������J� �?#�р�R��B�G��{�������#���C@�������5�@�����R��O�����G��@�@�B����T�@� �R�{B����#�_ֻ��_$Հ�!�R���_� �?#�{�����S�������uB"��@�@4�@��ҁ�sB"�`��SA��{è�#�_��Ҡ�� �R���?#��с�҂�B�G��c!��{��C�C@�����p���!�G��@��@�"@�c��ҡT�{A�����#�_փ��_$��?#�Cс�!�G��{����"@����Ҡ4aЛRH�Rac�r��r}�R�S�|���c���!�r�?' �|N�� /��=��@�q�T�A�������M��7�SD����G��@�@�B��ҡT�{C��C��#�_��S�N�� �_$�_�_$�_�_$Ձ��� �H�qd@��T`@9�qAT`@9�q�Td@9`���Q!?$q�Tc�d@8��Q!?$q���TD5?#�{��B�R�������{���#�_���_�_$�6�?#�{��!�R���S��R�[����RP�1T!�R�R�*J�1�T!�R@�RE�1 T��!�G�
q�Bz5@��������q�	Tq@TW4b�����B 5�!�Rv��`�R�����5�@��SA��[B��{Ĩ�#�_��@�$q���T`��R3���q�����
�@�$q���T`�!�R3���q�T�	5���G�@�	��q	T����b�!�RB 5�J��������@�$q�T!�R`�3����qA�R����b��*��B@3���6��W��5��b��*��B�3���.��q��T�@�b����*��B@3��SA��[B��{Ĩ�#�!�
q�Bz��5��!�G�3@����q�Tb���B�4���!�R���
q��T�����4 � ������*����b�B�3���������*��b�B�3����b����*��B�4��� � � �_$�_�_$�@4�_�a�`�! 6��6����?#�{�������� �a�!3�����5�@��{¨�#�_����@��{¨�#Չ� � �?#�{�����S��[�������@@����5����m��5�R�*�SA��[B��{è�#�_ր��G�@�������4a@��S<�*�4�4���a�!@7���R������*���������������*�SA��[B��{è�#�_օ�����A�����4��>��@��4���G�@�y�����4sS<t*���5��_$���_$է�_$թ� � �?#��т�B�G��{	��C��S
�������A@��G����R�����#������5�@�b�B�!�B����Rdjc8�4E�_8�k�T��q�T��q�Tc�B �(�T���G��G@�@�c���!T�{I����SJ�����#��@@�!*���@@��
!*�B �#�����R�����G��G@�@�B����T�{I���SJ�����#�_ֶ�� �?#��с�!�G��{��C��S���"@�����u��q-T�k�|@�9љ�a���!�7�)���5�[�z�_�R�c�Z�!�v��3������;!�қ������[��@�n���@�ZC��8�s�r7̃�;���	�@�DqA
T�@�sq����`
T��A�����c|ۛb�E�c�D�e�{�B|ۛ�˅�D�E�B�D�F�{�Eke8�|ۛ��%9f˃�Eӄ�DӅ�{�Fkf8c|ۛ��&9E�b�E�c�D�f�{�Eke8B|ۛ��%9��D�E�B�D�E�{�Fkf8�|ۛ��&9e˃�D�d�{�Eke8��%9B�Bkb8"9�����5�*����[C����cD��kE��3@���!�G��@�"@�c���T�{A��SB�����#�_�kE���R�������3@���[C��cD��kE������3@���[C��cD��kE���[��c��k��3�!��_$�i� � �_$�w�_$��_$�i� � �_$�=�_$�E�?#�{�������������#������`���@���{¨�#�_�'������3@�����*����@���� �?#�{���������S���@����`�L�u"������a
@�������T�`
����`��������SA����@��{è�#�_�`@�?�IT����B�b
����`
@����`������SA����`b�`����R��j��� � �_$� �?#�{�����S���@�@����m�����SA��{¨�#ՠ�`@�f����d�����SA��{¨�#՗��R�_�?#�т�B�G��{	��C��S
��*�[���@@��G���=����B�R��C�������@��5�@��`T@9	4��������`@��#����@4a@��*`��8�>���a@��*`��8�9������a@�k�T�*a�!�8�`�u�@9��b9�-��������q�@z�
T`@�a@���5`@�#��@5�R���G��G@�@�B����	T�{I��*�[@��SJ����#�_�a@��*`��.�
�����t4���G�a�R@��S�*��*�����������G�@�����*<�q�Ss@��*���*�������`�;���������G�@�����S�*<�q!*5�t��5s@��*�������`� :�q�������`� 8�l����t��<�������`��9�]�������?#�{������S����������~���*1�T����Rj��1�T���@��R�*�SA��{è�#�_ր��G���R@�sSs*�*�SA��{è�#�_ր��G�@�A���*�*a>q�S�*������@�����G�@�3�����4sS<�@�s*�� � �?#�{������S����[������*����	�;���*1�T����R���@�9��R���*��r ��1�T���Ra�����*�SA��[B��{è�#�_ր��G���R�SA�@��S�*�*�[B��{è�#�_ր��G�@�����*�*�>�q�S�*�������@���*�SA��[B��{è�#�_ր��G�@�����*���>�q�S�*��.�����SA��[B��{è�#� ��_$��R�_�?#����
�R��B�G��{����S	��*A@��?������#�������5�@yq�T�@�qIT�q�T�*�S�`�u�#���� ����+����j58�S@����G��?@�@�B���aT�{H����SI�����#�_��*`��� <������*`����<��������G�@����<qsSs*`�����*����`��;�w�����*`��
���=���p�����S��������������*`��>�e���S@��� � �?#�{����	����7���{���#� �R�_�{���#��R�_� � �?#�{�����S��ГZD��53����SA��{¨�#�_�������Z�����a�!�?������R�����`4�Z�����a�!������R������ 4������ZD����SA��{¨�#�_րZD�����Z��� �?#��с�!�G��{��C��[��Т�"�B@��) @��'����5v��B��S����s���j��`�N�������������@�7|@�� � T�?�!��T�9b�`���B�������@9�4����R����9��R�����`�9a�!@�����E�����������@�����Ri����5�@�a�!@.�`����,��c����`��k	���@�����������s
� � ���������F���M
T��@�ha8_(qDMz�Th!8!�?���T�@�[�����@�t��s@�����������4 � � �{#����T`@�����s@�������������5�kw8�qIz�T���kw8�qIz���T�qA��T����������U�����`��@�������	4@��#�������
4a���!������	5�@�����������������,��T ���/�� 5������@�����@�����'@�@5�@���@9�q@T�@�`���W���@�����@�����@������"�|����"�!�R��SF��cH��kI��sJ���"��#@�q`Tq�T�@���!�G��'@�"@�c��ҡT�{E��[G�����#�_֠
@����B�R��2���4�����h���@������d���@������`��1��<������`�����W���@���a���! 
�������4a���!
��� ��4��a�!`����'@�q�� *�'����c����*�9`����������@9�q T�cH����j!8����W����"�!�R�ҡ
��SF�����@�O��������<E�����@�@��<��������3����A���@�?���@�=���@�;���@�9���cH��kI��sJ���?-������`��������,������a�!`�'�������`�������cH����@�� @9�q�T`������[���@����@� @9�q T`�`����Q���@�?h 8 @94�@������aj`8?�q���T��"��@���@�`��@�@9�5�@�?h 8 @94�@������aj`8?�q���T��"��@���@���@9�5�@�?h 8 @94�@�������aj`8?�q���T��"��@��$�����<������@�@��,���h�������u���S��c��k	��s
�
��?#�{���R��A���`�����s�"�a@����@����{¨�#�_�a�!@��{¨�#����_�a�! 9��Ҭ�����`��@����{¨�#�_�?#�{�����S�@9!4����������_8�q�T���SA��{¨�#�_������������a��T�?�8���T @9�q`��T���SA��{¨�#�_������SA��{¨�#�_�?#�{��`�`9����S����`�����u����@9�5�@����SA��{è�#�_����������������Ҡ���������7��*���*S����Q����4��!�R�@��#9���SA��{è�#�_�t�������SA��{è�#�_�_$�`����_� � � �?#�{�����S��[���@9��a5�������ҔД�"��@�)���������������SA��[B��{è�#��y����s�����������a� ���Қ���������*���*
��������v��4��"�!�R�9�� �?#�{�����S��*��
����T�a���!������4�SA��{¨�#�_�A���!8�"����5�5��Ra���!`�������SA��{¨�#�x�a�!����R�������C��@������������?#�{��������s�"�`@����@��{¨�#�_�L�����J�`��@��{¨�#�_�_$Հ��c9q���_�_$�@�`6��_� � �?#��т�B�G��{
��C��S��c����"��[����k��*a@�C@��g������@�R����������������4���@�q�T�@�!2�"�!2��@� ���������G��g@�@�B���T�{M����SN��[O��cP��kQ�����#�_�����������5 � ��@�@q�T�@�!2�����4�"���@9 
4�@��@�2������o��������@�R��������R.���������a�! ����������K��t�����������5�@�@qT�@�2����5��<���@���������s�z����s��Z���c� �����*��������������������5�@�@q�T��@�����"��@�!2@�!2�� �����Ҟ������@����k�T�@�!2����4�����?���Ta�!������#@�!0@��j �A0�g����<�������@�k�������}�`�W����A�!8�'���qa�RAz��T�@�!2[���@�����k�T�@�@��Tx��K����@�q�T�@�2��9�5���]�����[����p���4�@�2��E���@�o��k��T�@�@�a�T=����A�!8�����qa�RAz�T�@�2��z������"����4�@��@�?q22���n����� �?#��с�!�G��{��C�����s�"�"@�����`"@�����!�G��@�"@�c���AT�@��{A�����#�_������`"����� �?#�{�� �R�����a��!@��{���#� ���_�?#�{���R������`�����s�"�a&@����@����{¨�#�_�a�!���{¨�#����_�a�!����c���`&��@����{¨�#�_� � � �?#�{���R�����`�����s�"�a*@����@����{¨�#�_�a�!	��{¨�#����_�a�!�	���c�B�c�	�B`6�;���`*��@����{¨�#�_� � � �?#�{���R������`�����s�"�a.@����@����{¨�#�_�a�!�	��{¨�#����_�a�!@
������`.��@����{¨�#�_�?#�{���R������`�����s�"�a2@����@����{¨�#�_�a�!�
��{¨�#����_�a�!�
������`2��@����{¨�#�_�?#��с�!�G��{��C��S���t�"�"@����Ҁ6@�����!�G��@�"@�c���aT�{A��SB�����#�_ր"@��s�"�a���! ���`6��������"������?#��с�!�G��{��C��S���t�"�"@����Ҁ:@�����!�G��@�"@�c���aT�{A��SB�����#�_ր"@��s�"�a���!`���`:������"�������?#��с�!�G��{��C��S���t�"�"@����Ҁ>@�����!�G��@�"@�c���aT�{A��SB�����#�_ր"@��s�"�a���!����`>��������"�������?#�{��������s�"�a�@�!5aF@��� ��`F��@��{¨�#�_�c�a�`�c�$�!��@�BʀR���c�a�`�c�$�!����bʀR���?#�{��"�RQ���S���a�"�"��<q�Td���$��`�b�A�B��!`.�#ۀR��R������a�!$�!X`x`�!� ֟$�t�"��~@� ��SA��{¨�#�_֟$�t�"���@� ����F@�@ �a���!��)�s�"�`����$�t�"��J@������F@��&�a���! 
��s�"�`J���$��SA��R�{¨�#�c���$�t�"��N@� ����F@� #�a���!�
�	�s�"�`N����$�t�"��V@������F@��%�a���!����s�"�`V����$�t�"��^@����F@��"�a���!����s�"�`^�����$�t�"��f@�@����F@���a���!����s�"�`f�����$�t�"��j@���F@���a���!����s�"�`j�����$�t�"��n@��F@���a���! ���s�"�`n�����$�t�"��v@�`�F@���a���!����s�"�`v�����$�t�"��z@����F@���a���!����s�"�`z�u���$�t�"��b@� ��F@���a���!����s�"�`b�h���$�t�"��r@����F@��	�a���!����s�"�`r�[���$�t�"��Z@����F@� �a���!@���s�"�`Z�N���$�t�"��R@�@��F@� �a���!@�z�s�"�`R�A���F@���a���!@�q�s�"�`~�8���R��`��&@�a�����a�!��d���R�����&@��$�����a�!��Y����R�����@�������a�!��N����R������@�!�����a�!��C����R������@�������a�!`�8�}���R����`��@�a�����a�!`�-�e���R�������@�������a�!�"����R����@��&@�������a�!���v���R����@��@�������a�!��^���R���� 	��@�!�����a�!��,���R~��� ��&@�������a�!`������Rs������&@�������A�!�����Rh��� 	��@�A	�����A�!�
������R]������&@������A�! �����RR������@�a�����A�!�����A�!���A�!����A�!@��A�!@����A�!�����A�!@����A�!@�m��A�!��T��A�!��F��A�!@�Y��A�!@����A�!@�i��A�!�����A�!@����A�!@����A�! 9��Ҙ��������A�!���ґ����&����A�! 9��Ҋ�����w��A�!���҃����&���A�! 9���|�����'��A�! 9���u�����L��A�! 9���n�����/��A�!����g����&����A�!����`����&�n��A�! 9���Y��������A�! 9���R�����J��A�!����K����&�-��A�! 9���D�������A�! 9���=������A�!����6����&��� � �_$� �R~�� � � � � �?#�{�����[�6�~S�B@q�T�S��*������*����~���B������������-�� ��q�Tb���B@%� � �e@9��c@9s�d�_8�S�|S�C*iA�cSe�_8_�f<cD*]�g<�S^�i<�E*Z�c<�Bӿnc�_8[�d<�S\�f<d�C*�n^�d<]�c<_n	n�n�
n�n����T�� T��T��@	T���
�aTd@9a�c@9!@%���S�|S�C*gA�cS&�d8%�e8$�g8!�c899	9
9����R���r_9!|��!�b�H!8�SA��[B��{è�#�_�(����R���[B��{è�#�_�d@9a�f@9!@%�e
@9�c@9�S�S�|S�S)D*EE*�A��C*lB�cS*�i8+�f8)�d8&�e8$�l8%�g8!�c89
9		9
9999��c@9a�!@%���d|ScS$�d8!�c8D$89��c@9a�e@9!@%�d
@9�fS�S�|S�C*�D*cAӄS)�e8'�g8%�f8#�c8!�d8	99	9
99���������SA��ҵ�� � � � �?#�����i�)�G����{��C����������
�����������������#@��'����������+)���<���<��_����7a�!�G��@��'@�"@�c��ҁT�{E�����#�_֧��@�w����@������x�� � � �?#�����i�)�G����{��C����������
�����������������#@��'����������+)���<���<��'��q�@�a�!�G�@����'@�"@�c��ҡT�{E�����#�_�F�� �?#�{�����S������[���@�@���?��T����������`@��`��SA��[B��{è�#�_ց�!�a�)��v@���`
���������R���`@��`��SA��[B��{è�#�_�>��@���R��_qB�b�`
@��[B��SA��{è�#�V?#�{�������� |@������`
����@��{¨�#�_�"��@�`���� � �?#�{�������� |@������`
����@��{¨�#�_�
��@�`����_$�@��5@�_�hT��_�@�B��a�����_$�@�qD@�AT�_։��_$ա�@��qD@�aT�R�_�?#�{����}����{���#��R�_�?#�{�����S����������a@�?q@��T�SA��{¨�#�_��������SA��{¨�#�b�� �?#�����i�)�G�����{��C����S���������������������#@��'����������+)���<���<��X��`�6���@���Rq�`�`��G��'@�@�B��ҡT�{E��SF�����#�_��@���<��a@�?q@��T������$����@���!���c��?#�{����@�����@�b5a�b@�"���R
�a��@��{¨�#�_���a@���`
@���
�b@��*����@���{¨�#�_�?#�����c�c�G�?�{��C���"���S���@�d@�����t
@� 5a@�A���R
�`���a�����(������a�!�G��@�"@�c���!T�{A��SB�����#�_��a@���a�`
@����
�`@�������
��_$���@��5@@���B@�"��_�_�?#�{��������{���#���_�?#�{��������@��4�@��{¨�#�_� <���q��R�`��@��{¨�#�_� �_$Ձ� �I�@5�_�?#�{������3�&�?�	�`@����bB�A�Ra���5�@��{¨�#�_���@�������@�@�{¨�#��"� �?#��`��G��{�����S�����&�@�����aN@�A4`*@��a�!�G�B�B`�@���@�"@�c���!T�{B��SC����#�_��#���������`*���&�!�R�N��`*@�������?#��`��G��{�����S���t�&�@����ҁZ@��4`��G�@�a�&� ���!0@�A� ?�s�&��5��!�`��G�!�Raj��@�@�B���T�{B��SC����#�_րN@�@4�*@��B�B`�@��A�!��k�����#������P���*�a�&�"�R"L���*@�������������@�P������@������@�R?��N�� �_$Ձ�!�&��* X@�_1@T"X��_�_$Ձ�!�&�q�� l@�"l��_�?#�C�h��G��{�����S�s�i�&�������*m@�������������@��7���j5 i@��4s�&��C��C��������������)!�R���<`@����<��=���<��=���<���ar@�!ar�`@�I��`��G��7@�@�B���T�{G��SH��C��#�_�e��������?#���c�c�G��{��C��k	�y�"�&��S��[��c�DX@��S�e@��'���5Tl@��5��@h@��*�46�&���@��?��r�����@��~���@����5�������Z���"��Z#�Q��;�&��A9V�R�T*q`T�5`s@�`s�q�T&q@T�q`_z�T�Qk
T��48�s@��������"��4���A9�T*qT��R�94���5`��G��j48�'@�@�B���
T�S@����{E��SF��[G��cH��kI�����#�_�Q�RkL��T�����~@�m����������R��_�����s@����~@����43�&�`@�W��bB�A�R��`5?�	������B�N����:�� 5�@�#�R�=#�	���=�@���<l��������Â<>����A�R�����4���@�]����@��������z�����@�T����@�����?�	����S��A�!����R��"�����@�R;��AТ�R! ����n��@�>����@������ � � �?#��h��G��{������������������@��7������S�s�`�&���l@��5h@��4s�&��C����������������)!�R���<`@����<��=���<��=���<���ar@�!ar�`@�J���SH�`��G��7@�@�B����T�{G����#�_��SH�����C������������)���<���<��=��=���V������S����?#�{�����[�v���&����l@�q�@��	T�S�����������_�@Tej�8���6_��T�����R`���������ITj48����A�!�?��������[B��SA��{Ũ�#�{���@T�iT5��&�h@��4����W�P��t���&��������c@9�@�(q`T�5�R��s��Tb@9��R�@�C�@��hcx�7�*s�����T�SA��@��[B��{Ũ�#�_֠5��&�h@�55����'���'@������� ����������SA��[B��{Ũ�#����������� 5�h@� 4���SA�����������������!�R������
�R����������SA��[B��{Ũ�#��� � �_$���������l�� � �?#�{�����S�t��&�aZ@�bn@�!*�5a>@�a�bB@�"�bj@���B4��&�B�B�2�@���r� ?��������������y�������������T������@����SA��{Ĩ�#�_��SA��R�{Ĩ�#�'���B@��� ?��@�Ҿ����Ry���@����SA��{Ĩ�#�_���x����@�a>@��� �?#�����i�)�G�����{��C��������3����
�����������������#@��'�����������+)���<���<�����`�7�@��������@����`��G��'@�@�B���T�{E����3@�����#�_���@������@���>�����_$�!�R�� �?#�{������u��&�l@�5�S�h@��4��&��Z@��5�r@��4�@���R(���r@�qMT � Ձ@��Rs���r@�kK��T��&���R�@����@�����r��SA��@��{è�#�_֟r��@��SA��{è�#�_ִ�&�����Z@�S��4����SA��?#�{������<����������h��*���*D���*�@��{¨�#�_�_$�g���&��0������	��_�_$�c�?#�{����c,E������*�R`?��*�5�R�*�@��{¨�#�_����!
�Rk�T�*�@��{¨�#�_� � �_$�a�#,E������R!�R��R�_�?#�{������s�s�&�an@�A5aF@��bj@�B4�@����{è�#���@��{è�#�_��������@�aF@��@����{è�#��?#�{������s�s�&�`n@�`5aJ@�!�`j@�`4�@����{¨�#� �R��@��{¨�#�_օ���aJ@� �R�@����{¨�#�� � �_$�a� �I�@5�_�?#�{������3�&�?�	�`@����bB�A�R����5�@��{¨�#�_�'��@�������@�@�{¨�#��R� �_$�`�(E�`����_� �_$�e������*�`J�BQ���(��j`T�@�$P6?#�{��������)��@��������?��@��5�R�{¨�#�_��R�_փ�����R��� �R�{¨�#�_� �?#�����b�B�G��{��C��S����R�@9@@�����%4q@�B� �B�2���B��A���!@�O��@�7�@���������������?���*�@�Z��`��G��@�@�B���AT�{A��*�SB�����#�_���<����?#�{�����S�����@�������R��B�R������*c�d�)����b`
��4����SA��{¨�#ս�_$�a�q�R� `
��_�?#���a�!�G��{�����S��[������c��C��#��k����� @������ � � �������������������������@������R�����*�4`��G��@�@�B��ҁT�{B��*�SC��[D��cE��kF�����#�_�����#�Rk����*<�q�T��4�A����3�!�������@�?q������R���������@
�5��R��2������y��R��A�! �J����*���R�����������5�Ҡ�R�������q�������2���R���������A��R!��1����*7�������R~����������5��R��2�w����Y���A��R! �����*��5����R@���T�����@�`T�������R_����������d@����T������-��<���?#��{
�����[�����`��G��S��*�c
��*�k��s��*@��O���Q�������������*5�q!T�6q@T��9�A���! ���A��� `�9c/���@����R���	�R�G��3@��*���R���qd@z�*���C� Tu��@9 4����R�������@9�q@5T����A��5���@����@���R@?�`������� &��Ҭ���3� (5@��!����a�R@�R�q T$���}���"��{h ��@�@�@"�`�!��"�D�!@��� �R�̭r?k`T!���!�/���� '4��!�!�/����A�q ��A�!@�!�����Ұ������R(����������������`5�3@��*���Ru���* 4�@���@�����*�*�s����	��*'5�_@�����"�R 
��* &5�3@���@��$��R;z�R�'� �R�C��'@���R������C@��*�C�^���C@��C��*���@��*���R�D���*�)4{{SH�R��r�?�Rk@�r{Ӂ�k�"T�A����4�R �rK`ЛR`c�rc|���C@�c�r�kM��T�C��q@*T�6qa��TA���R!�#��ұ���C@��������@���2��`��G��O@�@�B���A*T�{J��*�SK��[L��cM��kN��sO����#�_���9�A���!������@�`�9�/�<�R����'�R�G�"����RA���! �����@�����3��@��!���R�?�`�RC���*��
�������%����9�A���!`�����@��9�/��R�����R�G��������K���@��5�A��4�@�@�`�����q�T�3@�����������4<r`�T ���������4���@�2����0���@��5�3@�R�C��A�q�C@�@z`��T���<qT�*���@���@� '�����3@��S����G@�s*��� @yA�!���qA�T�����@4<r�K��
T�����@��������K@���*�����*�����*q<�S�*���*���B���@� ����������3@�����@����W������*q<�S�*��L��@�����@�!�z��������3@����������@����@��A�!@����3@�A���!�'����������Ҧ���*�3@��4�*s��-���A��*�@������*<�q`T��4�3@���3@��*���R8��@5������@���������}���*��������@���@��"�=���@�y���������@����������@�r��`@9����q��T��?���� 
���R�����8L����R�?k�3@��TA���!�'�����������X�� ��5�A�`�4A�! (���R�҆����,���҂���A��3� 4���q�T�6q`TA���R!�&���u���@�������@� �R�3�����T���@�R����P��"��A���R!#���b���C@����A���R!�%���[���@��A���R!@%���T���@���}������*�4�S<�*��1���3@�������?#��������*�
�!�R�{�����#@����3@����@��#������	����*�������{B�����#�_� � � �?#���{�����������*�����*������R�ҁ����{B�����#�_�?#���{�����������*�����*������R��m����{B�����#�_�?#���c�c�G��{�����S����#��[��*��`@������R�����b�B�G��
qC�A�c�(�!@)���!�����������Ҫ���*�4�������������`��G��@�@�B��ҡT�{C��*�SD��[E�����#�_�"����!�!�2�������ҍ����� ���R��<����?#���f���G��{��C��S����*�[������c����*�+��@����Ҡ�R������*�����������@��*�4<A��q!�)���R@�R��R���ҕ�����*t���������*
����s��`��G��@�@�B����T�+@��*�{A��SB��[C��cD�����#�_�����@�`��6��RA���! *�r��������&���������RA���!�*�g��������5�B���B -����ҡ�R�?���B����A�!+���R��T�������RA���!,�N��A�!�,�����������<���q�� � � � �_$�`�!�Rp
��_� � � �?#���c�c�G��{����S����*a@������4�#�b���@��T���S�����������*����+�U����@�`��G��@�@�B���T�{T��SU�����#�_���:��?#�{�����S�s�a�)��*!@��5s�)�!�R`@�a�@�?�!�!�)�"��@�RV�����������������@�RM��A�!�-�"��@�RH���*��������������@�R?�����A�@�R! .�:���*�R�Ң����*�SA��{Ũ�#���ӐR �r�k�T�[��*��R�c�X��-��k��̌R�R�R�̬r�kMTq��*�4��95�9�"��@�R��?q6����*`~:��q�b�|�Ka��T�[B��cC��kD����R������������!�"��! /�@�R������?#�{�������5��`���s�?�<���"�R@�RZ�����"�R�*V�����"�R��RR�����"�R`�RN�����"�R`�RJ����R@�R��!�<�E����@��R�{¨�#�!�Ҡ�R>��C�A�@�c�%�!�.��.�b�R���?#���`��G��{	��C��S
�s�s�)�@��G���a@��5�#���-����b���R���`��G�!�Ra��G@�@�B���!T�{I��SJ�����#�_�@�/����s��?#�{������s�s�)�`@�@4a����@�R�����@��{¨�#�_�@��/���� � �?#�{�����S���!��c������k�y�����[��o���@��3�
��s����@�������*���5���@T{��@T�z{������3�<����*{����T�sE��1�T�3@�`F������ 	�0������o@��
����~}������s����_09��]��@�hw����@�h7��R�SA��[B��cC��kD��{Ǩ�#�_֜@��*������3@��!��T���������@��o@�X{���sE��@��T�*������*�������������@���C�}���ha��j!�! ���T�����@��E��<��?#�{�����c�@����S�����[�@��#���s����Tu~}����ju��2�4���P���5����7�@�s��j5���h��T�SA��[B��#@��cC��{Ũ�#�_� � �?#�{�����[���@�_4q�TC�!�`�`�c�"�B|@�c@�#�`�B�|�hb����[B��{Ĩ�#�_��w���E�U��@����[B��{Ĩ�#�_�B|@�`���S�t��b��B�����`A�S������a��T��Y����������ҔB����3�R�����R!��t� ՁA�8s9��:qa��T�@����SA��[B��{Ĩ�#�_������[B��{Ĩ�#�_����<��U���A�@�! &�`0��0�����@��SA����?#�{���� �����
��@���`����E����`���`
������@��{¨�#�_����������_$�@�?#�{�����S���@�$�?��IT��@����@Xs�`������@�s�?�H��T��������SA��{¨�#���a�!@,�"@��i��T ���_�_$ա�?#�{�����S����� @94����R���`T��������R�SA���{¨�#ՠ���SA���R�{¨�#�_���������R�SA��{¨�#�_���R�_�_$�a�?#�{�����S�����"@9�4��������������������@��R�SA��{è�#�x�������R�SA��{è�#�_��SA���R�{è�#�_���R�_� � �_$��$@�`T?#�{�����[���!@9�4@����S����@����zs��2�t�9��`4s����T�@����SA��[B��{Ĩ�#�_ց
@���5�@��@��SA��[B��{Ĩ�#�_�@��SA��[B��{Ĩ�#�_�[B���{Ĩ�#�_���_�?#�{�����[����c����#���B�_��@�T�@9�4�S�@���@��� � � ��zs����2�t�����4s����T�������@�@9`4��0����������$�R���@���@����zs����2�t�����4s�����T�SA���#@��[B��cC��{Ũ�#�_ֹ��
@�`4 �R ��@��#@��SA��[B��cC��{Ũ�#�_�A���!�����@��5t������Rq���������SA��A���!�����@��5g�������SA��� �_$�$@��@z�T@��|@���BT@�����T�xd������$�c�@�a�b�@�A�0��_���_� � � � �?#���b�B�G��{��C��k	�y��R�S�T�s��[�6�,��C��c��*�B6��S��* �E�A@��'����s����7�R����
@�����~����
��#���R���#� � ����������4�/@�_�qT,T_<1�T_�qT�@������������@��5�����һ��3�E���A���!�6�������5`��G��'@�@�B���AT�S@��*�{E��SF��[G��cH��kI�����#�_�_�q�T_�qT�����
����@��
���:�R�'���8��4��RA���!�5�l���3@��@�?qA�!�5�!��������A���!�6����������4�*������!���!��>��� �E�;��3�����|�� � � � � � � �?#�{�����S������[��*�*���1�TV4`@��qB�B�7�A�!�7�!��0�����R���*�SA��[B��{è�#�_�`@��qB�B@7�!�!@.�!�����`��G�@����A�!�7��S�*�q<@*��R��������*����������/�*����SA��[B��{è�#�_�@��G�@�����*!�q!`8�<�S��R�*���������*�������w��`@���`@���/����?#�� �A�!�G�9��{�����S��"@�����z����`��������L@9!�Q!?$q(��TL�B�R��R��ks�������`��������`1�TA�!�G��@�"@�c���T�{B��SC����#�_��#���R��.��@5�@��*?1�T�k �R������R!��@4��Rf�������*?1!��T��R���@��*?1a��T����?#�{�����S��*�[����������*�����Rk-T���u�B|@�1�TB��zb�1�Tka��T�*s�k!��T�@��R�SA��[B��{Ĩ�#�E��*����k���T ��*s����k���T�@��R�SA��[B��{Ĩ�#�3�?#�C�G���G��{�����S����[������c��k��C��@������$I�� H��(J��)���)�#��R!� @���$ �"����B��xb��������|@�a������R��w���������S�c@��d"��� Ճj"�B ��hb������c��#������R@��5 @�1�Ts�9�q�T�R�@�5@@�k�T�*,��1@Ts��Z�qa��T���*p������������R��q;�{3�������� �1���TI��@������� ��9������������4q �3��9�sB9�s��7��@������� � :�t��3�sb9����?#���@��G��{	��C��c�@��G������*����Ҝ�����S
���qmT�R�R�[���k
��#� ��s������6�(T�����A������~~Ө�� ����Z4�s�*k�T���*2��1���T���@�$q��Tsk���T�[K��J4��kM��s@�����SJ�@��G��G@�@�B���!T�{I����cL�����#�_���������SJ��[K��kM��s@�����S
��[��k
��s���� � � �_$Ձ��*�R,��?#�{�����S�������*�R?1�T�SA��{¨�#�_�@��G�@����/<q�S�*���� �_$Ձ��*"�R��?#�{�����S������*�R?1�T�SA��{¨�#�_�@��G�@����/<q�S�*���� �?#�{�����S������1�T�SA��R�{¨�#�_�@��G�@����/<q�S�*����SA��{¨�#�_�_$�1AT�_�J�?#���/H��G��{����S����[������c��*���k������s	���D�	@���	�������m���
���	���F�������*�#���"�R�����*`5�*�C����R�����*�5��*�c�����R�����*�5������1�T 4�#@�1@T���/@�1@T���7@�1@T����u��@���v��@���t��@����R@��G��@�@�B���aT�{D��*�SE��[F��cG��kH��sI�����#�_�����*���#���"�Rb����*���4�����F����*���C����RU����*�4�'@�1T�#@�1`��T��������*�C����RE����*���4����*�#���"�R<����*��4����@�@�V����#@�1@T�����@��O����/@�1@��T��������	���������'@�1���T������+@�1��T�����@��G�@���*!�q!�:�<�S�*��R����U�����*4������׿���@���$����#@�1@Tz����@� �����/@�1@Ts����@�������7@�1 �Tl���w��j�������'@�1 ��Te�����@����������+@�1�T\�����3@�1 ��TW������E��M��� �R1���@������@���@���#@��*�/@����7@���������?#�{�����S������[����*�c��*�*ȿ��`�1@T�R�4�*�SA��[B��cC��{Ĩ�#�_�@��G�@�����!�!�:�bS�*q<@*��R��������;��@��������j����*�SA��[B��cC��{Ĩ�#�_� �R����*�*�*�����R��u���?#�C�D��G��{��C��S��*�c������@�����c��`��1 
T_q�[���������@�qT�*���*@��1���T��R5�[C�@��G��@�@�c��ҁ	T�{A��*�SB��cD��C��#�_��@���R�R 
k�T?@�!T?r`T7�!<H����[C�!�R���R!���! =������������&����*��R!���!;�~����`@����������*�������>5��5�[C��R�������������R����R!���!�;�g������a�R�[C������R!���!�<�]���@9�������[�����?#��E��G��{�����S����c����k����s����Ҧ@�������d���b����[�U�,��Җzs��1�T�@����� ���@����@��kA��T@�e����x��z3�9џ�T����x��z3���A��T���@��S�|�q��l����@�qT���*�����*1���T@4����T���z`�_kA��T�T�~��j`�_1�T�@�9��j ����T�R6�5��"=���;����R ��zt�1�T
�R_k`T@�T����R����A{t�j���$�R���� T����@����)ܽ���@)`���E����)����@�~�ӽ������@�@��G��@�@�B���
T�{B��SC��cE��kF��sG����#�O��r`��T;���R!���!�<�����A{t��zt�B<H�9���������R�Ҭ���A{t�2�����d�R��!��T�[D��<������@��G��@�@�B��ҁT�{B��*�SC��cE��kF��sG����#�_�<H��z4�����R���-����*��R!���!�=����������@�`@�������������@������R��� �`>�����$�R}������*@�5]���[�����_$�_� � � �?#�{�����S����[��������*����k�T@��G�a�R@�sSs*�*�SA��[B��{è�#�_���!�Ra��*�4@��G�s>�[B�@�S*�*�SA��{è�#�_����1�T5 �RK���&���1�T �`6�%���@5����1�T4�R����R�ҹ���1A��Tz���@�J����� ��>�������!�!�:���R�������l���@�<�����������@��G�@�����<qsSs*s���� �R����,��������@�����������*�*�R�ҝ���_$�1AT�_���R��� � �?#�{�����S��[��c�X�k������R�+������� ճ@9�����RsQ���s��fqhT���+@����SA��[B��cC��kD��{ƨ�#�_��u����������R���{sB�/qT`@�������_���T`@���V������5��U��;�4�t@�������_$�@�����_� � �?#�C�B�B�G��{����[�V��S�����E�C@����ҁ�!@���"@���T4@�T�@��G��@�@�B���	T�{D����SE��[F��C��#�_��� � �c��#����C��C������������������c�k���������@�����B����������@���������r����� ���������"����!�!�2�������?���`��������E����L��C@���cG�����C@����cG�����ҳ���c��C�m�������@�d����� ��?�Ҿ�� �?#����H��G�@��{��C��[���������������@��'���T�c�X�-��S����*@��*��s@���d
@��k���Tb@�_k!��Tab���ƾ�����5`
@��cH��SF� �������ջ������`�s���������C����������)�����<tV)���<��=��=\��`
���-�@�a���SF��cH�A�!�G��'@�"@�c���T�{E��[G�����#�_� ��2��0���@������ �@�n����S��c����� � �?#�{�����S��[����*�������@�Xq�T��S�`B-�@�@4`B-�!�R�4sB-�B� � -�@��!�Ra�)�@��SA��[B��{Ĩ�#�_֢�R!���!���������@���˽������$���`B-�!�R��S�w�!���! -�N����5`RK�!�RaR���5��R!���!���������
�����aB-�"�R @�"�@��5� � � �?#�C�DЄ�G��{���������)�S��[	��c
��k��s��@��7�������@�@-����R�@������@�6���@�@9w;4�����q�@� �@z�T ��7�;@�1@T��q�_z�T�k�T�;@��pq@zaT�����8��9�s���T$@9�A��6�q�T��q�T��q�!T��q�&T��q,T� � �������!�R@���9�s���T$@9���q �@z�T� � �������!�R-���9�s�?��T7�R�@�@�`�ܺ�����@����@���@�����?@�`-4V�95��"-���A����������`/T�@��#������+��� �|��/�?�h/T�������c��#��C������'�������$TW��B-�@�`)4�@��B-�!�R��Ż����û���@��R�@��;@�V�������%���@��G��7@�@�B���,T�{G����SH��[I��cJ��kK��sL��C��#�_�s�<���R�8��#���c��!�R9�ͺ������!�T � � ��R���|���R�9�(q�T�T�0q�T�4q`T�,q$T9���R�9s
�����`T$@9���@��9��9�@���`��T$@94��*�Q��qT�@��qD�48�@���AT�@�@�@4�
�9�s�5���A�Tk�����vS9�s�5����T$@9P��9��� ��T$@9�*�� ����qMT��� ��K4���d@8������!�RZ�u�������T�Q��$@9�H4��@���!�R �����h������?@� 4\�9�s�5�����T�R7��9��9�@���`�T$@94��W�R��� ����Ts�����9��8��A�T���@��`��R��������9��9�@����T$@94��w�R����(qT	T�0q`T�4q`T�,q�
T9�s
�?��T�R���qm�T������׹���������4� q�T@�R9��9s
�������T���R�9��9�@���@�T$@94�җ�Rg��|��vS9�s�5����T�@�����S�q��T�@����������������9��RA��9���R>��9��
�R;��9�@�R8��9���A�T�R��9��9�@����T$@94�ҷ�R;���4� q���T9�s���`�T$@9!�9h���'@��@�?9������q���T��*�@�!Д�: ��� �d@8������!�R��������T���H7����9�s
����T�R���9���!�Th���@��9��!�!����R�ғ�����A�����@������������������������,����s�����A���"�R�����@�c���@�`K��?�
��$�"Є�&�B@�!�!`.��P�R��R��ջ������ � � �?#�{�����S�������Y����T`@9���5@�B�@-�!�!��A���)�R�SA��{è�#�_�!���!�������4!���!�����`��4!���!�������4!���! ���� ��4��!�!`��[�5�����5@�B�@-��"-�U��!�R�)�[B���!���!`�b�������5`@9��Rt��qAz���T`@9t������RE���������"-����������4���������T`������������ TZ���@�B�@-�!�RS���)�[B���������R,����[B����������R%������ � � �_$�@��A��_�_$�@�\K��_�?#��A�!�G��{�����S����[�UгB-� @�����b@��5�;�`@�@
4�c�W�8���A�#-���]������@	T�@9���� ���4?y�A@8c�s�����5`��������������������C��c��#�������u�����T�@�9�������cF�@��G��@�@�B��ҁT�{C����;@��SD��[E����#�_֠B-�@�4�B-�"�R����������!�!����R�Ҏ�������@���A�������#-�����������A���"�R����`@��cF���4�;@�@��G��@�@�B��ҡT�{C����[E��SD����#Օ���@94������ G�A@8��a��5�/������@9a5����86$|S#��2c`299�@8���5_9�����_9��� ����c�t����c��;�q���_$�C�c`K����_$�ͻ�_$���_$Ս�� � �?#�C�{�����c
������S��[	��k����@�@��G��2�@��7���?��F��T��&�����	��C��C����@��Ry����*1�T���s��R��	qKTs� ���T�@���`T�����*����1a��TV���@����q���T�@� � �����z����@��@���@����@�@@��@������������#�"�Rc��`?��@��*������@���T����Ÿ���@��*�����sL������+q�T�*@9_(q�T�*9����R����*1T4��<�T��T�������sL�@��G��7@�@�B���a
T�{G��*�SH��[I��cJ��kK��C��#�_�sL���B��.��@�@���G���`��5���.@9(q�T �R ����*ѹ�����@��������@�4Д�	��*������@���@��*�@�����B�R�?���`T��n�����R�Y����sL����Ի��@����
q�T�@��*3О���s�������������@����@��@��@���������������"�R?���`T��J����*�5�������@�3�sB	���ۺ���@�����@����@���B�R�?����s�z���?#��B�B�G��{�������S����[����R�c���k�y��R:�s���R@@��o���Y�r`�2���@c
��� ՀB@9�7�@��@�2����@��#����`5�_@�?q�+T���������*1Tq���@�
q+T ��
������B@9�7�@��@�����@��#�e����4a���@���3��*sB�-������������@�W��@��@�%�����������"�R�?��*ͺ���GH���@�q!T�Rź���@��4�R!�RK����/��*1`��T�B@9� 7����*�#�����"�B`�#������*b��5���,�!T��B��*�@�a�.����@��T"���@��@���5��*�����������K����@����@��@��@�������������"�R�?��*���@�H����*�����A�!�G��o@�"@�c��ҡT�{N��SO��[P��cQ��kR��sS����#�_րB@9�
6����+@�k�
T!4�*�RM����4��@�q
T�/@������1�
T5���R�k`
T�*��T��oq-TX��E�b���`T@@@97B@�b����@��2��*:�@������@��@����E��@��� � ՟�`T`@@9�7c@�c�����2���2��*C������R?֠5�Re9�}�R��������ҥ�f��R�|�K�'���|�N�� ��=&�����Fq`�T�@��*5�i�����
�������ƶ���@����@��*�@�^�������������"�R�?�yS����+@�k��T��4�B@9@�7�/@��#��*����`5�_@��5�*R�������4�qlT�zS�"q�T�*u���~@��@��Е��ҕ���� *�����/�����R�"!K����@�Ћ��@�R��@�����*�*s���*��Rp���@�����#��*x�
���r����* ����@�����@��*������R�?ֵ��Ѓ�2�l��S����*�����R�����-���@���Rq�
�R ������%����*!�)�"��*�����T�*����`�5�B@9!2�B9����b��5��"
���A����@����@�����"�R�?��*�������߷�� � �?#�{�����S���@��G��[��c����k��s����aB@9@�����6����*�*"�B`���#�����۸��������q �@���R�����з��`���z��*Z@�Y���!�E�a�3��x����,�0�����`��� /���o���aB@9`�� 7���*������"�B`�����t@���a���`����*����"�B����������@����q�T�R/���`@��4�R!�R�����*1`��T��b�ҫ���,�!
T��C��������*��������<�����T��*!�)�"�ҙ�����T�*k���@$5t@���������`4����@�w@���4��*���Q�������������w@�w�xjB��*H����������R�����?��*���@�v@�4�`@� ������*7�������������v@�v��@�u^B�.���������"�R�����?� #����*a��P���@���w@�6�`@� ��֢��*���������w���w@�w��@�ufB����������"�R�����?��*���`@�u���`@�ŵ����õ���*������A�!�G��A�"@�c���T����SA��[B��cC��kD��sE��{ƨ�#�_�������RZ���_k<8�������ô��`�@�������!�!��"@�!@y�y`B@9 7�������{�/�4�R'��`@��������*`@��5�Ҍ����`@������?��������������@��@�_�A��TL�����H������4y@���������������kKT����z�����R8���aB@9��!xaB9u����t@���R���������`��������*��	5V�����T���`B@92`B9�����w@�6�`@� ������*������������w@�w��@�tbB�}�����������R�����?�`@�6�����4����* ���q����?����@��H��������4������R����Cy@������������5�@�k���TƸ�������`@�¸��`B@92`B9f�������
���4��6`@�
���`@�����������R�C��`B@92`B9���j���@���q!�T������������������������F����������`@��-���`@� ������$��O���@�b@�"��`@�����`@�ܴ����ڴ���*Ʒ����_$�@�!�Rx��_� �?#�{�����S��*4�[���s06�uG�sv�F�zrT��R������U���-��@�`4V���r!��T�R�RzrA��T�� �Ҵ�������D���-�@@9�rS�*��@�!tc*@9�534�SA����[B��{è�#�_ր�E�c2@���C@9����SA��[B��{è�#�_��0-�=� �R��V������SA����[B��{è�#�� � �_$��$@�@T���_� �_$���_�_$�@��_� � �_$����_�_$�`	�C�?#�{����a�E��������������!@��a��T`���`B@9a
@��7"}�_ �`T�6`@�@�����b@���"�aB@9�6a
@�#��!�? �TD���`@�B������@��{¨�#�=����a
@� � �"��`@�!���? ��T��aB@9A6��.���`@�,������@��{¨�#�'��Է��`@�������_�a�����?#�{��@������E�������s@����������@��{¨�#�_�_$Հ�@@9�_��R�_�_$�@@9�7C7����?#�{�� ��� �A@������{���#��R�_��R�_� � � �?#��B�A�!�G��{��C�#@�����A�E�A��S���@@9A7a6���ҽ����*1@T`B@9@7����k!T�@��4`@����@	5`B@9x`B9�SB��RA�!�G��@�"@�c����	T�{A����#�_��SB��a@�4������K���e@����d@���a@�����R�?��SB��8�������5�����*��G���e@���a@��*����b�R�?֠�R�����@���SB����������4��"���5@�1���d@���a@�����"�R�?��*v�������a@�4��b�@������e@�����d@���a@���"�R�?���S������� � �_$�����?#���B�B�G��{��C��S�����C@�����A��!�R�5@��G��@�@�c���AT�{Q��*�SR�����#�_����#�����`4�R����#�����`��5�@��G@�?��T�@��K@�?�������� � � � � �?#�{����R���S�����[��c��*�#
��k�C�����R��9���!#�=�����R��!���!@�7�����R��!���!`�1����������� 5a@9�*�4��[���`�`@9 4�������5a@9�4��P�����`@9�R�4#
������ 4a@9�*�4 #�C���`�`@9 4�*�SA��[B��cC��kD��{Ũ�#�_�4�R�*�SA��[B��cC��kD��{Ũ�#�_� � �_$��R���?#�{����R���S�����[��c��k��!#
��s�����R��!���!@������Ac
���R��ܵ��;���Ra#�����ֵ������R!���!`�е��<���R�������ʵ������������@4�R�SA��[B��cC��kD��sE��{ƨ�#�_��������5����|�`5u@954���*����`@9��4���*ܴ�����*��ش��`�`@9 5�SA���[B��cC��kD��sE��{ƨ�#�_����*ɴ������`@9@5�SA� �R�[B��cC��kD��sE��{ƨ�#�_�!#
���������4Ac
������ ��4t@9���4`#��*����`�`@9��4�*�������@���`@9q��Z���?#�{����R���S�����[��c��*!�!���k�c�����R��!���!��]�����R��8���#�W�����R��9���!C�Q����������@43�R�*�SA��[B��cC��kD��{Ũ�#�_��*��������5�@9�4���*m������@9`��4!���!`�������4!���!����� ��4!���!��������4�@9�*U��4#��*U���`��@9���5���*��N��������@9���4��* C�G�������@9q���� � � � � �?#�{�������� ��������*�������?#�{���*������q@TLT@�R�(q�T`�R�Pq�T�q��R�~|@��C���=_�=k����{è�#�_��R��q���T~|@���q��R��R��C���=_�=\����{è�#�_�~|@��C���R��=_�=S����{è�#�_� � � �?#�{��@��������K�a5!�R���6��R!���! �������O����@��R�{¨�#�_֢�R!���!�������C��� � �?#�{�������������������� Th�8���6?�T�RC�b@9P�������˳�����@��{¨�#�t�����������@��{¨�#Վ�� � � �@9�qT�Q��$qh	T�R@8���Q��$qI��T$��7@9?�q�T@9���q`T��Q $q�T�R � � Յ@8 ��Q%�$qI��T@��7�@9�q�T�@9����q�T��QA?$q(T�R � � �@8!A��QD�$qI��Ta��7�_�@9�R��Q��$q��T��_�@9�Q$qI��T�R��?�����@9!�Q!?$q)��T�R��_�����_� � �?#�{���������t�������v����{���#��������?#�{�����S�����q!�!���*��R<���������*���������� � � �?#�{����A������{���#�_���?#�{��������!���!`�����!�q @����@��{¨�#�_�?#�{�����S��� �����R����*!�!��ѳ�����*�@����SA��{è�#�K����R!�!@�ų����!��SA�!@��{è�#�@��_$�`�@9?�q@T�_�@9!�!`�_q ���_� �`��_�_$�`�@9?�q@T�_�@9!�!��_q ���_� ����_�_$���?#����*$��G����{��C��@������9�9�� ��G��@�@�B��ҡT�{A�����#�_ְ��� � � �_$�����?#�{�����S���������m����������SA���{¨�#����s�2������SA���{¨�#��һ�� � �_$��?#�{�����S�������5�b@9��B|S_$q@�B�@����b@8��B_$q@�B�@������T�@��SA��{è�#�_�_�?#�{�����S��k��
�_q�����[�� ��c��*��"���+�
?k�T?pq@zAT�c��Ta@9?�q _z���T?4qTA$���6c����T�����R����[�R�
�R�k@T�pq@z�Td9�������T�@9`���q�_zH��Tv9�(q�T�4qT�0q T�,q�T� qT@�R��`9s
���a��T�+@����[B��cC�9�SA��kD��{ƨ�#�_�������Rs
�`�8��s
�z�8��v9���c��!�Rs�����s
�{�8����Rs
�`�8����R��Ra9� ��ͮ��������9�SA��kD��{ƨ�#�_�d��5�Rs
�`�8��� � �?#�{����w������{���#�_֡���?#�{�����S�������������������@9���5��a8�@9�4?pqa��T�@9�
�_�q 	T�T_pq`T�T_�q`T_�q!T��b8�@9�5 � �9���@��SA��{è�#�_�_�q`TT_�q`T_�q�T!�R��a8��_�q�T_�q�T��R��a8���R��a8����R��a8������R��#$8b9����_�q��T?��1`T���5��R`&x���a�R��a8�����a8���A�R��a8���`8����
@9�@yay`5s
�����@9`
9�4��s�a�8���s���� �?#�{�����S����[�5����������u�������������s�<����4`@9�q�T@��5�SA��[B��{è�#�_�`@9s�@��5����SA��R�[B��{è�#�_��SA� �R�[B��{è�#�_� � � �?#�����"�B�G��{�����@�A@����ҡT�R!�!�G��@�"@�c����T�{B�����#�_��#�����l��������3����S��C�e���������@� �R�@�k���TA��T�@��@�k�T���T�@��@�kL��T��T������� *|S������?#�{�����[��������S���@9�qdIz�T�@8�qdIz���T�q T�@9�q�T���!��i���@5�`�1����@�B��s�� � աA���(����@������@�4qT�@����SA��R�[B��{Ũ�#�_ր@9 ��5�`�����@�����s�Qs&q	T���!��k������ ��c�@����Z#����@����@9���4�@�����a@�sB�����'���`��5�@�`@���4��� � � ���O����@��kD��*�cC����R�c��k�z����������R�����7�����T�@� *�����������S�ϰ���@����B���a@�sB���`@��@�_j@��T�������������5���������)����SA����a@�?�q��T�SA��������!@�ݯ���5������R�����R���!`����@��������m�����R���kD�� � � �?#�{�����[������
��S����c�@9�qIz�T � �`@8�qIz���T`@9�q`T���!������ 5���t����@�a���b��b.���m������b��_�a������@��R4qaT�@�*���SA��cC��R�[B��{Ũ�#�_�`@9@��4���!���������4�R�k������!��k�0����@
�@��	�� �Z#����@�4��@9���4�@�����a@�sb�!���h���`��5�@�`@��4����������@��kD�*���SA��cC�������W����5�ҿ���������S�����@����B���a@�sb��`@��@�_j@��T��7��������)�3����SA�������!@�5���`5�����������������R���SA���cC��kD���� � � � � � � �_$�"���B@�
��?#�{�����{���#�_�GPL-3.0-or-later@GPG@-connect-agent (@GNUPG@)2.4.7Copyright (C) 2024 g10 Code GmbHGNU/Linux
Home: Please report bugs to <@EMAIL@>.
Usage: @GPG@-connect-agent [options] (-h for help)Syntax: @GPG@-connect-agent [options]
Connect to a running agent and send commands
can't open '%s' in "%s" mode: %s
file '%s' opened in "%s" mode, fd=%d
sending descriptor %d failed: %s
invalid fd
given fd has not been opened
%dcan't put fd %d into table
variables nested too deeply
cwdhomedirsysconfdirbindirlibdirlibexecdirdatadirserverpidinvalid argument '%s' for variable function 'get'
valid are: cwd, {home,bin,lib,libexec,data}dir, serverpid
unescapeunpercentunpercent+percent+	
percent+errcodeerrsourceerrstring%s <%s>+-*/%!|&unknown arithmetic operator '%c'
%ldunknown variable function '%.*s'
no handler for inquiry '%s' found
sending data back failed: %s
error executing '%s': %s
handling inquiry '%s' by running '%s'
rberror opening '%s': %s
handling inquiry '%s' by returning content of '%s'
error reading from '%s': %s
D[%04X]  %02X   D ?CANCELagentdirmngrkeyboxdgpg-connect-agentS.uiserverNote: '%s' is not considered an option
option "%s" requires a program and optional arguments
--execoption "%s" ignored due to "%s"
--raw-socket--tcp-socketcannot open run file '%s': %s
assuan_new failed: %s
assuan_pipe_connect_ext failed: %s
server '%s' started
can't connect to socket '%s': %s
connection to socket '%s' established
assuan://can't connect to server '%s': %s
error allocating session environment block: %s
no dirmngr running in this session
no keybox daemon running in this session
no gpg-agent running in this session
error sending standard options: %s
receiving line failed: %s
../../tools/gpg-connect-agent.cloopidx < (int)DIM (loopstack)/end/end command vanished
.gpg-connect_historyerror reading '%s': %s
> error reading input: %s
stopping script execution
end of script
line too long - skipped
line shortened due to embedded Nul character
/whileletsletshowvar%-20s %s
definqdefinqfiledefinqprogdatafile-wbcan't open '%s': %s
showdef%-20s %c %s
*cleardefechosendfdrecvfdThis command has not yet been implemented
opencloseshowopen%-15d
GETINFO pidcommand "%s" failed: %s
server's PID is %lu
hexnohexdecodenodecodesubstnosubstrunsyntax error in run command
cannot nest run commands - stop
running commands from '%s'
whileblocks are nested too deep
ifendstray /end command encountered - ignored
trueyesbyequitsleephistory--clearOnly "/history --clear" is supported
helpAvailable commands:
/echo ARGS             Echo ARGS.
/let  NAME VALUE       Set variable NAME to VALUE.
/showvar               Show all variables.
/definq NAME VAR       Use content of VAR for inquiries with NAME.
/definqfile NAME FILE  Use content of FILE for inquiries with NAME.
/definqprog NAME PGM   Run PGM for inquiries with NAME.
/datafile [NAME]       Write all D line content to file NAME.
/showdef               Print all definitions.
/cleardef              Delete all definitions.
/sendfd FILE MODE      Open FILE and pass descriptor to server.
/recvfd                Receive FD from server and print.
/open VAR FILE MODE    Open FILE and assign the file descriptor to VAR.
/close FD              Close file with descriptor FD.
/showopen              Show descriptors of all open files.
/serverpid             Retrieve the pid of the server.
/[no]hex               Enable hex dumping of received data lines.
/[no]decode            Enable decoding of received data lines.
/[no]subst             Enable variable substitution.
/run FILE              Run commands from FILE.
/if VAR                Begin conditional block controlled by VAR.
/while VAR             Begin loop controlled by VAR.
/end                   End loop or condition
/history               Manage the history
/bye                   Terminate gpg-connect-agent.
/help                  Print this help.unknown command '%s'
sending line failed: %s
SCDHELPclosing connection to %s
error writing '%s': %s
@
Options:
 verbosequietprint data out hex encodeddecode received data linesconnect to the dirmngrconnect to the keyboxduiserver@raw-socket|NAME|connect to Assuan socket NAMEtcp-socket|ADDR|connect to Assuan server at ADDRexecrun the Assuan server given on the command lineno-ext-connectdo not use extended connect mode|FILE|run commands from FILE on startuprun /subst on startupno-autostartno-verboseno-historydo not use the command history fileagent-programdirmngr-programkeyboxd-programchuidunbufferedGnuPGgnupg2utf-8../../common/stringhelp.c(char*)(result + n + 1) == bufferthere is a bug at %s:%d:%s
HOME
fatal: getcwd failed: %s
 	
.
fatal: too many args for xstrconcat

fatal: out of memory

 1.9.1%s is too old (need %s, have %s)
libgcrypterror setting envvar %s to '%s': %s
can't disable core dumps: %s
/dev/null%s: WARNING: standard output reopened
%s: WARNING: standard input reopened
%s: WARNING: standard error reopened
%s: fatal: unable to reopen standard input, output, or error
gnupg_allow_set_foregound_window%s called with invalid pid %lu
renaming '%s' to '%s' failed: %s
XXXXXX-rwxuser '%s' not found
USERLOGNAME/usr/local/bin:/usr/bin:/binPATHGNUPGHOMEerror unsetting envvar %s: %s
error setting supplementary groups for '%s': %s
error switching to user '%s': %s
could not getsockname(%d): %s
file descriptor %d is not a unix-domain socket
socket name not present for file descriptor %d
socket name for file descriptor %d was truncated (passed %zu bytes, wanted %u)
failed to allocate memory for name of fd %d: %s
/pinentry/pinentry-basic/proc/self/exeGNUPG_BUILD_ROOTerror reading symlink '%s': %s
/bin/gpgconftrying fallback '%s'
value too large/bin/gpgconf.ctlerror getting %s from gpgconf.ctl: %s
.enablefactsocketdirinvalid rootdir '%s' specified in gpgconf.ctl
invalid sysconfdir '%s' specified in gpgconf.ctl
invalid socketdir '%s' specified in gpgconf.ctl
/usr/bin~/.gnupgcan't create directory '%s': %s
directory '%s' created
/run%s/user/%u/d./etc/gnupg/usr/lib/gnupg/libexec/usr/lib/aarch64-linux-gnu/gnupggnupg/lib/usr/share/gnupg/share/gnupg/usr/share/locale/share/localeS.gpg-agentS.dirmngrS.keyboxd../../common/homedir.c! gnupg_module_name_called! gnupg_build_directory/agent/gpg-agent/gpg-agent/scd/scdaemon/scdaemon/tpm2d/tpm2daemon/tpm2daemon/dirmngr/dirmngr/kbx/keyboxd/keyboxd/agent/gpg-protect-tool/gpg-protect-tool/dirmngr/dirmngr_ldap/tools/gpg-check-pattern/gpg-check-pattern/sm/gpgsm/gpgsm/g10/gpg/gpg/g10/gpgv/gpgv/tools/gpg-connect-agent/gpg-connect-agent/tools/gpgconf/gpgconf/tools/gpg-card/gpg-card/tools/gpgtar/gpgtarrootdir/var/runestream_asprintf failed: %s
tcsetattr() failed: %s
/dev/ttyr+cannot open '%s': %s
Sorry, we are in batchmode - can't get input
Sorry, no terminal at all requested - can't get input
tcgetattr() failed: %s
Control-D detected
x%02xestream_vasprintf failed: %s
putenv=OPTION %s%s=%sASSUAN_DEBUGGPG_TTYlc-messageslc-ctypestarting_agent ? 0 0gpg-agentstarting_dirmngr ? 0 0starting_keyboxd ? 0 0gnupg_spawn_agent_sentinelgnupg_spawn_dirmngr_sentinelgnupg_spawn_keyboxd_sentinelgnupg_spawn_unknown_sentinelerror allocating assuan context: %s
connection to the %s established
no running %s - starting '%s'
error building filename: %s
error flushing pending output: %s
--homedir--use-standard-socket--daemonfailed to start %s '%s': %s
waiting for the dirmngr to come up ... (%ds)
waiting for the keyboxd to come up ... (%ds)
waiting for the agent to come up ... (%ds)
connection to the dirmngr established
connection to the keyboxd established
connection to the agent established
can't connect to the %s: %s
RESETGETINFO restrictedconnection to the agent is in restricted mode
SCD GETINFO versionGETINFO versionerror getting version from '%s': %s
server '%s' is older than us (%s < %s)WARNING: %s
Note: Outdated servers may lack important security fixes.
Note: Use the command "%s" to restart them.
gpgconf --kill allserver_version_mismatch 0: signal 0123456789 caught ... exiting
../../common/signal.c!modesignals are already blocked
signals are not blocked
GPG_TTY,TERM,DISPLAY%s: error allocating string: %s
ttynameTERMttytypedisplayXAUTHORITYxauthorityXMODIFIERSWAYLAND_DISPLAYXDG_SESSION_TYPEQT_QPA_PLATFORMGTK_IM_MODULEDBUS_SESSION_BUS_ADDRESSQT_IM_MODULEINSIDE_EMACSPINENTRY_USER_DATApinentry-user-dataPINENTRY_GEOM_HINT[cmdline]reading options from '%s'
common.confsocket:tcp:log-fileuse-keyboxdr,nonblockw,nonblockwerror creating a pipe: %s
error creating a stream for a pipe: %s
/proc/self/fderrinoutfailed to open '%s': %s
dup2 std%s failed: %s
error forking process: %s
waiting for process %d to terminate failed: %s
error running '%s': probably not installed
error running '%s': exit status %d
error running '%s': terminated
waiting for processes to terminate failed: %s
PID %d was reusedwaitpid failed in gnupg_spawn_process_detached: %smap_static_macro_string failed: %s
map_static_strings failed: %s
EMAILhttps://bugs.gnupg.orgGNUPGGPGgpgGPGSMgpgsmGPG_AGENTSCDAEMONscdaemonTPM2DAEMONtpm2daemonDIRMNGRG13g13GPGCONFgpgconfGPGTARgpgtarconversion from '%s' to '%s' not available
iconv_open failed: %s
\x%02x../../common/utf8conv.cconversion from '%s' to '%s' failed: %s
isoiso-8859-18859-1646ASCIIANSI_X3.4-1968utf8error opening lockfile '%s': %s
error reading lockfile '%s'
error reading lockfile '%s': %s
invalid size of lockfile '%s'
invalid pid %d in lockfile '%s'
(deadlock?) lock not made: open(O_EXCL) of '%s' failed: %s
%10d
lock not made: writing to '%s' failed: %s
lock not made: Oops: stat of tmp file failed: %s
cannot read lockfile
lockfile disappeared
removing stale lockfile (created by %d)
waiting for lock (held by %d%s) %s...
unknown%.*s/.#lk%p.%s.%dfailed to create temporary file '%s': %s
can't check whether hardlinks are supported for '%s': %s
.lockerror writing to '%s': %s
Oops, '%s' is already locked
Oops, '%s' is not locked
release_dotlock: lockfile error
release_dotlock: not our lock (pid=%d)
release_dotlock: error removing lockfile '%s'
yYnonNqQokay|okaycancel|canceloOcCokayokcancellibgcrypt problem: %s
out of core in secure memory while allocating %lu bytesout of core while allocating %lu byteserror allocating enough memory: %s
AES128AES%s:%u: obsolete option "%s" - it has no effect
WARNING: "%s%s" is an obsolete option - it has no effect
--[stdout][stdin]|enabled debug flags: %savailable debug flags:
 %5u %s
,noneallunknown debug flag '%s' ignored
enabled compatibility flags:available compatibility flags:
unknown compatibility flag '%s' ignored
�������,�(�$�������������� 
������tmf_ZUOJ<72AEmaindo_strtokenizedo_make_filename-rw�x@r wxrwxabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789"(5BO\iv�����gnupg_set_builddirgnupg_module_nameybndrfg8ejkmcpqxot1uwisza345h769gnupg_init_signalssession_env_list_stdenvnamesdo_utf8_to_native;0	%�������H	d���\	����p	��	$����	D����	D����	ij��
p���D
H���x
���
�������D����d����P��4����L��
���
���T���h���|�����������d�����,,��Xp����������4���X���(�� ��4��|��������$� ��Dt�p�����$����d�T��L�����t�$�@��h���������$��D��d�����0��D$�X��lt�������d�������4�����H�\���pH��������������@���T$���h�����������L��p�������������X����������(������8���L���x,���D�������	��	��$�	��X�	��l�	����
����
���D
��L
��$p
��8�
��h���������������D�� �������������������������,D��`$�����������\h���t����� D��4 ��l �"��D!t#���!$$���!%��"$%��0"&��d"�&���"'���",'���"D'���"d+��4#�+��`#,���#�,���#D-��$�-��\$L.���$�.���$�/���$,0��(%�0��P%D9���%d9���%d<���%D=��$&>��L&�>���&D?���&�?���&�?���&�?��'$@��4'�@��h'�A���'B���'�B���',C��(�C��L(D��|(�D���(�E���(F���((F���((G��,)$J��p)hK���)�M��D*�M��X*�N���*�O���*�O���*�P��D+Q��l+,Q���+�Q���+�Q���+DR��,�R��<,DS��l,dS���,T���,�T���,LU��-hU��-X��\-Pa���-�a���-b���-db��.tc��H.de���.�e���.0f���.�g��(/�h��P/Li���/�i���/�k��0Dl��P0�m���04n��1�n��41do��t1p���1�p��02�r���2s���2Du���2�v��<3x��h3�x���3{���3�|��`4}���4�}���4�}���4~��5$���L5$����5���6�����6Ĉ���6����7����7����X7ċ��l7�����7$���$8d���\8Ę���8�����8�����8Ě��9T����9d����9l����9t����9�����90���l:�����:����;Į��;���d;$���x;0����;D����;P����;�����;б�� <��4<D���X<D����<P����<$���=����T=����h=�����=D���>t���8>D���p>Ļ���>d����>���>(���?���� ?����D?��l?p����?�����?���?��?d���@p���(@��\@l����@����@��� A���PAD���A4���A$��\B����BzRx����4A,���0@���<$TD���PA-A ��B�N���A-|p����x����4�d���xA-A ��B��e
����A-AO
����A-A0������A-A0��B��C��T
������A-A0$����A-A0��B��C��i
������A-ApHȪ���A-A@��B��C��^�J�D������A-A@������-V������A-A@�������-G
�D������A-AG� �� A-A��C��A-0���tA-A ��C��M
����A-AG����A-D8����A-A ��G��J
��A��A-AA��B��A-B ��-A��A-D\t���TA-ApA��B��D��B�S
�������A-A_
�������A-A\������
A-ApC��B��C��H��n��L������A-Ap��������-}��E�����A��t���`A-A`��C����F��C�	�
A��B��A��A��D������A-A`�
�	����������-{������B�
�	����h|�����A-A0��B��Z��X��B����A-A0����-C��N��D
����A-AD����A-A0������-t�,����A-A@��D�����f�B�y�B�H@C������A-A���������-K�A�E��G��F��I
�B�AI�B�B�A�t`p���dA-A�B��E�
�	C��B��D��u
����������A-AĜ�d��p��L��F��Y
��AX��H��R
��AT��D��H�t���pA-A`��G�
�
�	��������~
`G������������A-A$(�� 84��L@��<(`l���A-A ��B��O
����A-A ���A-A��C��A- ����lD-A��R��A-$�X��LA-A ��E�J���A-(�|��|A-A ��C��O
����A-A$(���DC-A ��B�H���A-$P���`A-A ��B��R����A-�x ���A-AP�
�	B��C��B��Y
��A��B����A-AL�Y�D��A��G����A-AP��������
�	-M�E
��B��B����A-AA��A��A�����A� ���0A-A��G��A-p(���A-A`��B��B�	�
C��A��h��i��C��A��A��C����A-A`�
�	��������-F��R��D��A��A��P�4�� A-AP�
�	B��B��B��_�j
�E��������A-AY�H
��������A-AE����xDh��HA-A�A��B�
�	D��G����C��j
������������A-A0Lh���A-A ��B��[
����A-AC����A-D����,C-A0��B��C�m
�����A-AD
�����A-AI�����A-������t��� �����R-A ��R��A-(	x���A-A ��B��d
����A-A@	����$T	���tA-A ��B��W����A-4|	����C-A@��B��C��C��X��������A-4�	8���C-A@��B��C��D��X��������A-4�	����C-A@��B��C��C��W��������A-4$
���C-A@��B��C��D��W��������A-,\
p��HA-A ��C�F
���A-AC���A-0�
���tA-A ��C��P
����A-AC����A-$�
����A-A�E��b
��A-A$�
T���A-A�E��b
��A-A$����A-A�E��b
��A-A$8d���A-A�E��b
��A-A`���t���`�,�������x�<���H���T���`��l��4���4(����<p���P���hdH�t,x���M-A��I��A-C��-A��A-$��PA-A ��B��N����A-D�,��C-A@��B��B��C��U
��������A-AE��������A-
��,
��@@
��DA-A�A�
�	B��E����C��i
����������A-A$�
���A-A�C��c
��A-A$�
 �A-A�C��d
��A-A8�
��A-A@��B��C��C��j
��������A-A��$��@8���A-A@��C����B�c
�������A-AF�������A-0|@��A-A@��C��C��D�T�������A-$����A-A0D��b
��A-Ad�t��A-A`��B�
�	C����F��C�����A��E��������A-A`�
�	����������-F��A��l@��\A-A`��B��B��D�	�
E��C�w��A��A�D������A-A`�
�	���������-��A��A�B�
�	B�����$���LA-A ��B��M����A-8���|A-A ��B�M
���A-AE
���A-AC���A-8(,�|A-A0��B�B��M
�����A-AH�����A-dl�(x`��C-A ��F��Z
����A-C$��DC-A ��B�I���A-8�$��A-A0��B��D�H
�����A-AQ�����A-��(x��A-A@D��B�^
���A-A(H$��A-A@D��B�W
���A-At��,���dA-A0��B��C�J
�����A-A$���dA-A E��O
��A-A���0����A-APC��K��V��I
��A-AA��(��<x� Pl��[-A��E��A-t��T����A-A@��C��B��V�Q�C
������A-Ad
�AL�Q�H
������A-AW�A��,�� �$,0�LA-A ��B�H
���A-AC���A-<8T� A-A0��C����O
������A-A^
������A-Ax4��(���8��<A-A�C��B��k
����A-AX
����A-A���PA-ApC��B�
�	H��I��C��C�O��B��A��A�J����A-Ap�
�	����-A��D�������A
�B��A��A��AB�B��A��A��B��A��A��A�������������������0���lA-A ��D�G�B��A-A ���-H�@0���A-A0��B�B��V��C���A-A0�����-L
��BC��0tx���pC-A ��B��I
����A-AG����A-0�����pA-A�C��B��B�I
�����A-AL���A-A0��D��D�K�D
����A-AI����A-A0�����-M
�AH�X,����dA-A0��C��B��^
������A-AJ
������A-AR
������A-AP������A-�����4������A-A�D��B��S�J�K
����A-Ae�J�,�����8A-A��E
��A-BA��A-4����A-A ��B��G
����A-A\
����A-A�<�����A-A�C��B��K�	�
z��C��G��{��A��A��A��Q
����A-AB�
�	������Y��������B�
�	������T������A��L��J
��AC������V��A��A��A��T��A������I������L��A�	�
A��A��A��D����A-A ��E�E�B��A-A ��-C��A-B ���-G�B��A-<\����A-A ��B��L
����A-AR
����A-AD����A-L�P���A-A0��D��C�F
�C����A-AX�D����A-A0����-E����A-����0����A-A0��C����T
������A-A44����A-A ��B��M
����A-AN
����A-A,l ��PA-A ��B�F
���A-AF���A-�@���D��<�H��A-A�C�
�	C����E����k
����������A-A((��|A-A0C��B�Q
���A-A 0|��0A-A��G��A-DT����A-A ��E�E�B��A-A ��-C��A-B ���-G�B��A-D�����A-A ��E�E�B��A-A ��-C��A-B ���-K�B��A-D�(	���A-A ��E�E�B��A-A ��-C��A-B ���-G�B��A-D,d	���A-A ��E�E�B��A-A ��-C��A-B ���-G�B��A-(t�	���A-A0C��B��Q
����A-A(�
���A-A0C��B��Q
����A-A(��
���A-A0C��B��Q
����A-A$��
���A-A ��B�J
���A-A4 T���A-A ��D��\
����A-A^
����A-AX���\l����A-A0��B��E��_��B����A-A0����-F����A-A0������-F��$�`���A-A�E��d
��A-A$����A-A�E��e
��A-AH����A-A0��B��C��Q
������A-AR
������A-AK������A-$hP��LA-A ��B�I
���A-A$�|��LA-A ��B�I
���A-A����8���� ����@I-A��C��A-0���\A-A ��B��J
����A-AE����A-,8��A-A�E��C��f
����A-A,h����A-A ��C�K
���A-AL���A-(�<���A-A0E��D��]
����A-A ����HK-A��C��A-0���TA-A ��B�E
���A-AH���A-,0��|F-A ��B�J
���A-AG���A-(L����A-A@C��B��V
����A-A(x��0A-A@C��B��`
����A-A���$��� ,�$��A-A�C��B��t
����A-A@�����A-A�C��B��G�
�	�����S
�����������A-AD@ � ��DA-A�C��M��`��I��A-A�����-A��O��B��A���� �!��4A-AP�
�	B��H��^
��A����A-AI�_��A�B����A-AP�����
�	-F
�EG
��B����A-AB
�BE
��AB�A�B�H�B��B����A-!X#��\(!d#��A-A@��B��L�Y�C����A-A@����-C����A-A@�����-J
�C����A-A(�!$$���A-A�E��E�f
���A-A�!�$��H�!�$���A-A0��B�E��^��B���A-A0�����-C
��A���A-AF��$"x%��HA-A ��B�L���A-<"�%�� ,P"�%��pC-A ��C�J
���A-AG���A-�"�%��(8�"&��xA-A0��B�K
���A-AB
���A-AG���A-8�"<&��xA-A ��B�K
���A-BB
���A-AF���A-,#�&��|F-A ��B�J
���A-AG���A-<#�&��,T#�&���N-A ��L��A-C ��-F��A-(�#H'���A-A0D��B��j
����A-A$�#�'��hA-A ��B��T����A-�#<(��<�#D(���A-ApC�
�	C����C��C��i
����������A-AH,$�*��L	A-A�A��B��E�
�	B��C�����
������������A-A x$�3��hA-A0F��P��A- �$�3��PA-A0A��O��A- �$4��PA-A0A��O��A-0�$H4��A-A`C��B��C��j
������A-A@%$5���A-A`C�
�	B��C��C��C�p
���������A-A\%�6��4p%�6���A-A�C��B��N�H�J
����A-AA�L�%P7���A-AP�
�	B��s
����A-AE��C��C��[
��A��A��AD������$�%�8���A-A ��B�b
���A-C, &X9���A-A�C��B��Z
����A-A(P&�9��PA-A ��B�K
���A-A`|&�9��A-Ap��
C��C��C��D�
�	E��Y��b����������A-Ap���
�	��������
-P��<�&�;���A-AP�
�	B��C��C��B�T��A��A�B����A-� '�;���A-A@��B��S
����A-AA�D�C����A-A@����-C�A��`�B��B����A-A@����-D����A-A@�������-L�A��$�'�<��lA-A ��D�O
���A-A0�',=���C-A ��B��T
����A-AG����-<(�=���C-A ��B��Q
����A-AC
����A-AF����A-LD(�=���C-A0��B��F�H�C����A-A0����-D
����A-AC����A-h�(8>���E-A@��B��F��B�K
�B��B����A-AE
�A��B����A-AA�A��B����A-A@����-C����A-h)�>���A-AP�
�	B��B��B�I��l��E�������A-AP��������
�	-H
��C�������A-AL
��AH��l)�?��pD�)H@��$A-A�C��B��C�
�	C��C��C�D
�����������A-A<�)@B���A-A0��B��C��U
������A-Ae
������A-A(*�C��LA-A@E��B��g
����A-A@8*�D���A-A@��B��C���]
�������A-AP�������A-0|*@E��A-A�C��B�
�	B��E�����|�*G��tA-A�C��E��G�	�
F��B��C�_��B��A�C��K����A-A��
�	����-B�����C��A��A��A�C�	�
A��A��A�(0+H��|F-A ��B��H
����A-A(\+pH��|F-A ��B��H
����A-A0�+�H��pA-A ��B��G
����A-AM����A-�+I��H�+I��A-A�D��B�
�	B��C��C��C��Q
������������A-AH,�L��A-A@��B��C��C��M
��������A-A[
��������A-Alh,�M���A-APC��B��B��L��Q��L������A-AP��������-N
��BZ
��BC��B��I
��AI��A����,�N���A-A�C��B�
�	B��B��B��K��n��R����������A-A��
�	����������-X��Q����������A-A��
�	����������-C��B��]��A��|-�Q��<�-�Q���A-A0��B��B��Q
������A-AO
������A-A�-|S��@�-�S��A-A`��D�
�	����B��D�V
�����������A-A(.LT��P<.PT���A-A�C�
�	B��B��Z
������A-AD��C�p
�B��AA�B��D��A�`�.�U���A-A�E��B��L��C��T
��A��A^��A��J
����A-AC����G����A��A��4�.�V��4A-A@��C����C�Y
�������A-AD,/X��TA-A�C��I�
�	���������
������������A-A@t/`���A-A0��B��S
����A-AX��K��T��X
��AE
��B�/�a���/�a����/�a���A-A�C�
�	B��B��H�C��i��J�C������A-A���������
�	-`��B�L������A-A�������
�	-d��A���A��A�l0�c���0�c���0�c���0�c��|�0�c���A-A�A��B��E�
�	����[��{��B��V��N����������A-A��
�	����������-A
��Am��d��N��A��H<1�f��lA-A�C��C�
�	B��C��B��C���
������������A-AH�1�l��A-A`��B�
�	E����D������
`F������������A-A�1�s��H�1�s��8A-A0��B��C��m
������A-AI
������A-AK������A-42�t��H2�t��\2�t��p2�t��@�2�t��@D-A ��C�g
���A-AT
���A-AE���-A ���-$�2�u��@A-A ��C�I���A-�2�u�� 3�u��LG-A��F��A-`(3�u���A-A@D��G��X��J��A-A@����-A
��AN
��AC�P�B��A��A�Q�A�P���A��A��3�w��0�3xw���A-A�C��B��S
����A-AL�3x��XA-AP�
�	C��D����D��~
����������A-AG����������A-$4(y��l84 y��A-A`��C�
�	E������C��l
������������A-Aa
������������A-AM
������������A-A@�4�z���A-AP�
�	C��D����D��_
����������A-A�4 |��0A-A��454|���A-A0��U
��A-AM
��A-AG��A-$@5�|��xA-A ��C�P
���A-A,h5$}���A-A ��B�W
���A-AF���A-�5�}��x �5��DA-A��J��A-�5 ��PA-A ��B�� �5\��$A-A��D
��A-A$6\��DA-A ��B�K���A-@<6x���A-A0��B��F�G�C����A-A0����-I����A-�6���<�6���<�6���$�6���hA-A E��P
��A-A�6H���0�6@���lA-A ��B��K
����A-AG����A-(,7�����C-A0��B��C�V�����A-pX7܀��A-A`��C�
�	��E��C��D�~
�B��A��D������A-A\�����I������A-A`�
�	���������- �7����$A-A��D
��A-A,�7�����A-A0��B��B�f
�����A-AH 8,����A-A0��B��B��U
������A-AH
������A-AD������A-$l8�����A-A0E��P
��A-A��8h����A-AP�
�	B��D��g��C����A-AP�����
�	-P��D��`��B��C
��A��AL��D��Q����G����D
��AD��B������Q����D��A���,9�����A-AP�
�	B��D��B��i��A��C����A-AP�������
�	-J
��AD��`
��C��A��AG������D��U��A������O��B��A���9Љ��GNU�z�zH���а�P���@�H�P���X�`�p���������ȼؼ����0�H�0�8�P�8�X�`�h�p�x��������������������
�
�
�
�
�
�F
��P�X����o@�`
Sx��3'	p���o���o&���o�oD$���oo G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G(� �U@[�	� �����X-Шv��q���p��������0���H��`�p�Sx���T����E��� �0�r��X�s������p����p����Ȫ��p���p���p���p� �p�u(�p����p����p����p���p���/usr/lib/debug/.dwz/aarch64-linux-gnu/gpgconf.debug�H��ߏ���k�c��bT�bdecf953baffff3b3df40f3dc8a62554933159.debugL��2.shstrtab.note.gnu.property.note.gnu.build-id.interp.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.note.ABI-tag.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.gnu_debugaltlink.gnu_debuglink�� $1$$9���o@@C``�K��SS���oD$D$�`���o&&�o''yB33���F�F~ G G�@[@[T;@����������
3�����4	������9��� �P�P��X�X��`�`���(�(�P�x�x���������H4D"

Filemanager

Name Type Size Permission Actions
X11 Folder 0755
7z File 38 B 0755
7za File 39 B 0755
7zr File 39 B 0755
HTMLLinker File 71.49 KB 0755
JxrDecApp File 66.24 KB 0755
JxrEncApp File 67.63 KB 0755
RTIMULibCal File 66.55 KB 0755
RTIMULibDrive11 File 66.34 KB 0755
X File 274 B 0755
Xorg File 274 B 0755
Xvnc File 1.54 MB 4755
Xvnc-core File 11.77 MB 0755
Xwayland File 2.34 MB 0755
[ File 66.34 KB 0755
aa-enabled File 66.17 KB 0755
aa-exec File 66.36 KB 0755
aa-features-abi File 66.38 KB 0755
aarch64-linux-gnu-addr2line File 67.08 KB 0755
aarch64-linux-gnu-ar File 67.09 KB 0755
aarch64-linux-gnu-as File 454.99 KB 0755
aarch64-linux-gnu-c++filt File 66.47 KB 0755
aarch64-linux-gnu-cpp File 1.07 MB 0755
aarch64-linux-gnu-cpp-14 File 1.07 MB 0755
aarch64-linux-gnu-elfedit File 66.98 KB 0755
aarch64-linux-gnu-g++ File 1.07 MB 0755
aarch64-linux-gnu-g++-14 File 1.07 MB 0755
aarch64-linux-gnu-gcc File 1.07 MB 0755
aarch64-linux-gnu-gcc-14 File 1.07 MB 0755
aarch64-linux-gnu-gcc-ar File 66.52 KB 0755
aarch64-linux-gnu-gcc-ar-14 File 66.52 KB 0755
aarch64-linux-gnu-gcc-nm File 66.52 KB 0755
aarch64-linux-gnu-gcc-nm-14 File 66.52 KB 0755
aarch64-linux-gnu-gcc-ranlib File 66.52 KB 0755
aarch64-linux-gnu-gcc-ranlib-14 File 66.52 KB 0755
aarch64-linux-gnu-gcov File 516 KB 0755
aarch64-linux-gnu-gcov-14 File 516 KB 0755
aarch64-linux-gnu-gcov-dump File 387.93 KB 0755
aarch64-linux-gnu-gcov-dump-14 File 387.93 KB 0755
aarch64-linux-gnu-gcov-tool File 452.03 KB 0755
aarch64-linux-gnu-gcov-tool-14 File 452.03 KB 0755
aarch64-linux-gnu-gprof File 132.26 KB 0755
aarch64-linux-gnu-ld File 2.38 MB 0755
aarch64-linux-gnu-ld.bfd File 2.38 MB 0755
aarch64-linux-gnu-lto-dump File 28.02 MB 0755
aarch64-linux-gnu-lto-dump-14 File 28.02 MB 0755
aarch64-linux-gnu-nm File 67.93 KB 0755
aarch64-linux-gnu-objcopy File 199.7 KB 0755
aarch64-linux-gnu-objdump File 394.74 KB 0755
aarch64-linux-gnu-pkg-config File 67.96 KB 0755
aarch64-linux-gnu-pkgconf File 67.96 KB 0755
aarch64-linux-gnu-python3-config File 3.07 KB 0755
aarch64-linux-gnu-python3.13-config File 3.07 KB 0755
aarch64-linux-gnu-ranlib File 67.09 KB 0755
aarch64-linux-gnu-readelf File 779.66 KB 0755
aarch64-linux-gnu-run File 3.07 MB 0755
aarch64-linux-gnu-size File 66.8 KB 0755
aarch64-linux-gnu-strings File 66.93 KB 0755
aarch64-linux-gnu-strip File 199.71 KB 0755
ab File 66.31 KB 0755
aconnect File 66.24 KB 0755
acyclic File 66.44 KB 0755
addr2line File 67.08 KB 0755
agnostics File 67.13 KB 0755
airscan-discover File 195.26 KB 0755
alsabat File 66.29 KB 0755
alsaloop File 131.18 KB 0755
alsamixer File 132.1 KB 0755
alsatplg File 130.24 KB 0755
alsaucm File 66.69 KB 0755
amidi File 66.25 KB 0755
amixer File 66.3 KB 0755
aplay File 130.29 KB 0755
aplaymidi File 66.24 KB 0755
aplaymidi2 File 66.25 KB 0755
apropos File 67.12 KB 0755
apt File 66.24 KB 0755
apt-cache File 130.38 KB 0755
apt-cdrom File 66.32 KB 0755
apt-config File 66.24 KB 0755
apt-extracttemplates File 66.32 KB 0755
apt-ftparchive File 258.33 KB 0755
apt-get File 66.32 KB 0755
apt-listchanges File 230 B 0755
apt-mark File 66.32 KB 0755
apt-sortpkgs File 66.25 KB 0755
ar File 67.09 KB 0755
arch File 66.46 KB 0755
arecord File 130.29 KB 0755
arecordmidi File 66.26 KB 0755
arecordmidi2 File 66.27 KB 0755
aria_chk File 5.52 MB 0755
aria_dump_log File 5.33 MB 0755
aria_ftdump File 5.33 MB 0755
aria_pack File 5.4 MB 0755
aria_read_log File 5.52 MB 0755
ark File 259.2 KB 0755
arpaname File 66.16 KB 0755
arping File 66.63 KB 0755
as File 454.99 KB 0755
aseqdump File 66.24 KB 0755
aseqnet File 66.28 KB 0755
aseqsend File 66.24 KB 0755
aspell File 194.37 KB 0755
aspell-import File 2 KB 0755
attr File 66.16 KB 0755
autogsdoc File 453.64 KB 0755
autotouch File 1.28 KB 0755
awk File 776.39 KB 0755
axfer File 130.34 KB 0755
b2sum File 66.46 KB 0755
base32 File 66.45 KB 0755
base64 File 66.45 KB 0755
basename File 66.45 KB 0755
basenc File 66.45 KB 0755
bash File 1.35 MB 0755
bashbug File 6.8 KB 0755
bc File 130.68 KB 0755
bcomps File 66.58 KB 0755
bdftopcf File 66.6 KB 0755
bdftruncate File 66.41 KB 0755
bluemoon File 66.23 KB 0755
bluetoothctl File 654.75 KB 0755
breeze-settings6 File 66.25 KB 0755
btattach File 66.23 KB 0755
btfdiff File 1.29 KB 0755
btmgmt File 194.34 KB 0755
btmon File 1.07 MB 0755
bunzip2 File 66.23 KB 0755
busctl File 130.46 KB 0755
busybox File 898.71 KB 0755
bwrap File 130.3 KB 0755
bzcat File 66.23 KB 0755
bzcmp File 2.17 KB 0755
bzdiff File 2.17 KB 0755
bzegrep File 3.69 KB 0755
bzexe File 4.78 KB 0755
bzfgrep File 3.69 KB 0755
bzgrep File 3.69 KB 0755
bzip2 File 66.23 KB 0755
bzip2recover File 66.16 KB 0755
bzless File 1.27 KB 0755
bzmore File 1.27 KB 0755
c++ File 1.07 MB 0755
c++filt File 66.47 KB 0755
c89 File 428 B 0755
c89-gcc File 428 B 0755
c99 File 454 B 0755
c99-gcc File 454 B 0755
c_rehash File 6.76 KB 0755
camera-bug-report File 5.37 KB 0755
cancel File 66.16 KB 0755
cancel-rename File 2.04 KB 0755
captoinfo File 130.28 KB 0755
cat File 66.49 KB 0755
catdoc File 67.76 KB 0755
catman File 66.6 KB 0755
catppt File 67.23 KB 0755
cc File 1.07 MB 0755
ccomps File 66.68 KB 0755
cct File 66.34 KB 0755
cd-create-profile File 66.16 KB 0755
cd-fix-profile File 66.16 KB 0755
cd-iccdump File 66.16 KB 0755
cd-it8 File 66.16 KB 0755
cec-compliance File 324.31 KB 0755
cec-ctl File 393.61 KB 0755
cec-follower File 194.93 KB 0755
certbot File 959 B 0755
certtool File 259.34 KB 0755
cgi-fcgi File 66.02 KB 0755
chacl File 66.16 KB 0755
chage File 138.9 KB 2755
chardet File 221 B 0755
chardetect File 221 B 0755
chattr File 66.17 KB 0755
chcon File 130.45 KB 0755
check-language-support File 2.71 KB 0755
checkgid File 66.17 KB 0755
chfn File 69.1 KB 4755
chgrp File 130.46 KB 0755
chmod File 66.46 KB 0755
choom File 130.32 KB 0755
chown File 130.46 KB 0755
chromium File 5.78 KB 0755
chrt File 130.32 KB 0755
chsh File 67.6 KB 4755
chvt File 66.66 KB 0755
cifscreds File 66.52 KB 0755
ciptool File 66.32 KB 0755
circo File 66.43 KB 0755
ckbcomp File 147.15 KB 0755
cksum File 130.48 KB 0755
classes File 67.95 KB 0755
clear File 66.17 KB 0755
clear_console File 66.09 KB 0755
cloud-id File 967 B 0755
cloud-init File 971 B 0755
cloud-init-per File 2.06 KB 0755
cluster File 600.55 KB 0755
cmp File 66.91 KB 0755
cmstart File 84 B 0755
codepage File 66.29 KB 0755
codiff File 194.8 KB 0755
col File 66.32 KB 0755
colcrt File 66.32 KB 0755
colormgr File 66.2 KB 0755
colrm File 66.32 KB 0755
column File 66.32 KB 0755
comm File 66.47 KB 0755
compose File 18.57 KB 0755
con2fbmap File 66.01 KB 0755
convert-dtsv0 File 66.27 KB 0755
corelist File 15.01 KB 0755
cp File 194.48 KB 0755
cpan File 8.16 KB 0755
cpan5.40-aarch64-linux-gnu File 8.19 KB 0755
cpio File 198.73 KB 0755
cpp File 1.07 MB 0755
cpp-14 File 1.07 MB 0755
create_xauth File 104 B 0755
crontab File 66.59 KB 2755
cs2cs File 66.27 KB 0755
csplit File 66.46 KB 0755
ctracer File 194.76 KB 0755
ctstat File 66.59 KB 0755
cupstestppd File 66.24 KB 0755
curl File 322.34 KB 0755
cut File 66.46 KB 0755
cvlc File 45 B 0755
cvtenc File 68.46 KB 0755
cvtsudoers File 397.23 KB 0755
cx18-ctl File 66.47 KB 0755
danetool File 195.34 KB 0755
dash File 194.59 KB 0755
date File 130.46 KB 0755
dbilogstrip File 1.35 KB 0755
dbiprof File 6.06 KB 0755
dbiproxy File 5.27 KB 0755
dbus-cleanup-sockets File 66.16 KB 0755
dbus-daemon File 258.48 KB 0755
dbus-launch File 66.01 KB 0755
dbus-monitor File 66.16 KB 0755
dbus-run-session File 66.16 KB 0755
dbus-send File 66.16 KB 0755
dbus-update-activation-environment File 66.16 KB 0755
dbus-uuidgen File 66.16 KB 0755
dbwrap_tool File 66.38 KB 0755
dconf File 66.09 KB 0755
dd File 130.5 KB 0755
ddcmon File 12.75 KB 0755
deallocvt File 66.62 KB 0755
deb-systemd-helper File 23.79 KB 0755
deb-systemd-invoke File 6.97 KB 0755
debconf File 2.8 KB 0755
debconf-apt-progress File 11.57 KB 0755
debconf-communicate File 623 B 0755
debconf-copydb File 1.68 KB 0755
debconf-escape File 668 B 0755
debconf-get-selections File 1.72 KB 0755
debconf-getlang File 6.94 KB 0755
debconf-loadtemplate File 944 B 0755
debconf-mergetemplate File 5.09 KB 0755
debconf-set-selections File 3.14 KB 0755
debconf-show File 1.78 KB 0755
debugapp File 985 B 0755
decode-dimms File 106.79 KB 0755
decode-edid File 5.24 KB 0755
decode-vaio File 6.15 KB 0755
decode_tm6000 File 66.52 KB 0755
defaults File 68.82 KB 0755
delaunay File 67.3 KB 0755
delv File 69.15 KB 0755
desktop-file-edit File 132.33 KB 0755
desktop-file-install File 132.33 KB 0755
desktop-file-validate File 132.6 KB 0755
devdump File 199.98 KB 0755
df File 130.94 KB 0755
dh_bash-completion File 4.42 KB 0755
dh_installxmlcatalogs File 9.22 KB 0755
dh_numpy3 File 3.51 KB 0755
dh_perl_dbi File 1.17 KB 0755
diff File 195.52 KB 0755
diff3 File 131.05 KB 0755
diffimg File 66.45 KB 0755
dig File 194.72 KB 0755
dijkstra File 66.61 KB 0755
dir File 194.9 KB 0755
dircolors File 66.46 KB 0755
dirmngr File 646.59 KB 0755
dirmngr-client File 130.75 KB 0755
dirname File 66.45 KB 0755
dirsplit File 16.74 KB 0755
dm-tool File 66.16 KB 0755
dmesg File 132.63 KB 0755
dmypy File 234 B 0755
dnsdomainname File 66.09 KB 0755
dnssec-cds File 67.13 KB 0755
dnssec-dsfromkey File 66.25 KB 0755
dnssec-importkey File 66.24 KB 0755
dnssec-keyfromlabel File 66.26 KB 0755
dnssec-keygen File 66.26 KB 0755
dnssec-ksr File 66.26 KB 0755
dnssec-revoke File 66.25 KB 0755
dnssec-settime File 66.25 KB 0755
dnssec-signzone File 130.29 KB 0755
dnssec-verify File 66.26 KB 0755
dnstap-read File 66.19 KB 0755
docutils File 216 B 0755
domainname File 66.09 KB 0755
dos2unix File 74.17 KB 0755
dot File 66.43 KB 0755
dot2gxl File 67.05 KB 0755
dot_builtins File 66.54 KB 0755
dotty File 2.04 KB 0755
dpkg File 386.9 KB 0755
dpkg-architecture File 14.84 KB 0755
dpkg-buildapi File 1.79 KB 0755
dpkg-buildflags File 8.14 KB 0755
dpkg-buildpackage File 30.32 KB 0755
dpkg-buildtree File 2.12 KB 0755
dpkg-checkbuilddeps File 7.45 KB 0755
dpkg-deb File 194.59 KB 0755
dpkg-distaddfile File 2.72 KB 0755
dpkg-divert File 194.67 KB 0755
dpkg-genbuildinfo File 18.69 KB 0755
dpkg-genchanges File 17.51 KB 0755
dpkg-gencontrol File 14.62 KB 0755
dpkg-gensymbols File 10.66 KB 0755
dpkg-maintscript-helper File 20.63 KB 0755
dpkg-mergechangelogs File 8.7 KB 0755
dpkg-name File 6.58 KB 0755
dpkg-parsechangelog File 4.83 KB 0755
dpkg-query File 194.66 KB 0755
dpkg-realpath File 66.32 KB 0755
dpkg-scanpackages File 8.45 KB 0755
dpkg-scansources File 9.15 KB 0755
dpkg-shlibdeps File 32.59 KB 0755
dpkg-source File 23.18 KB 0755
dpkg-split File 194.44 KB 0755
dpkg-statoverride File 130.47 KB 0755
dpkg-trigger File 130.45 KB 0755
dpkg-vendor File 3.18 KB 0755
driverless File 66.18 KB 0755
driverless-fax File 537 B 0755
dtagnames File 194.74 KB 0755
dtc File 199.87 KB 0755
dtdiff File 680 B 0755
dtmerge File 66.5 KB 0755
dtoverlay File 66.98 KB 0755
dtparam File 66.98 KB 0755
du File 130.47 KB 0755
dump_xsettings File 66.35 KB 0755
dumpkeys File 195.07 KB 0755
dumpmscat File 66.16 KB 0755
dvdauthor File 195.68 KB 0755
dvddirdel File 876 B 0755
dvdunauthor File 130.25 KB 0755
dvgrab File 386.18 KB 0755
dvipdf File 1007 B 0755
eatmydata File 2.74 KB 0755
ec2metadata File 8.38 KB 0755
echo File 66.45 KB 0755
ed File 66.41 KB 0755
edgepaint File 472.24 KB 0755
edit File 18.57 KB 0755
editor File 324.81 KB 0755
eepdump File 66.5 KB 0755
eepflash.sh File 4.31 KB 0755
eepmake File 66.46 KB 0755
egrep File 41 B 0755
eject File 130.16 KB 0755
elfedit File 66.98 KB 0755
enc2xs File 40.97 KB 0755
encguess File 2.99 KB 0755
enchant-2 File 66.16 KB 0755
enchant-lsmod-2 File 66.16 KB 0755
env File 66.86 KB 0755
envsubst File 66.25 KB 0755
eom File 514.24 KB 0755
eps2eps File 639 B 0755
eqn File 265.28 KB 0755
evince File 515.63 KB 0755
evince-previewer File 66.62 KB 0755
evince-thumbnailer File 66.25 KB 0755
ex File 1.79 MB 0755
expand File 66.47 KB 0755
expiry File 66.45 KB 2755
expr File 66.45 KB 0755
f2py File 216 B 0755
f2py3 File 216 B 0755
f2py3.13 File 249 B 0755
faad File 68.05 KB 0755
factor File 130.46 KB 0755
faked-sysv File 66.74 KB 0755
faked-tcp File 66.78 KB 0755
fakeroot File 3.91 KB 0755
fakeroot-sysv File 3.91 KB 0755
fakeroot-tcp File 3.9 KB 0755
fallocate File 66.32 KB 0755
false File 66.45 KB 0755
fastfetch File 1.51 MB 0755
fbcli File 66.24 KB 0755
fbd-theme-validate File 194.24 KB 0755
fbset File 66.16 KB 0755
fbtest File 66.25 KB 0755
fc-cache File 66.24 KB 0755
fc-cat File 66.24 KB 0755
fc-conflist File 66.24 KB 0755
fc-list File 66.24 KB 0755
fc-match File 66.24 KB 0755
fc-pattern File 66.24 KB 0755
fc-query File 66.24 KB 0755
fc-scan File 66.24 KB 0755
fc-validate File 66.24 KB 0755
fcgistarter File 66.17 KB 0755
fdp File 66.43 KB 0755
fdtdump File 66.25 KB 0755
fdtget File 66.25 KB 0755
fdtoverlay File 66.25 KB 0755
fdtput File 66.25 KB 0755
ffmpeg File 386.45 KB 0755
ffplay File 194.62 KB 0755
ffprobe File 265.73 KB 0755
fgconsole File 66.64 KB 0755
fgrep File 41 B 0755
filan File 131.97 KB 0755
file File 66.48 KB 0755
file2brl File 66.09 KB 0755
filezilla File 4.38 MB 0755
find File 259.49 KB 0755
findmnt File 131.82 KB 0755
fio File 1.82 MB 0755
fio-btrace2fio File 66.23 KB 0755
fio-dedupe File 66.32 KB 0755
fio-genzipf File 66.28 KB 0755
fio-verify-state File 66.16 KB 0755
fio2gnuplot File 21.73 KB 0755
fio_generate_plots File 4.09 KB 0755
fio_jsonplus_clat2csv File 12.92 KB 0755
firefox File 848 B 0755
flock File 66.38 KB 0755
fmt File 66.45 KB 0755
fold File 66.45 KB 0755
fonttosfnt File 66.62 KB 0755
foomatic-rip File 143.23 KB 0755
free File 66.23 KB 0755
fsnotifywait File 66.24 KB 0755
fsnotifywatch File 66.24 KB 0755
fullcircle File 1.39 KB 0755
funzip File 66.43 KB 0755
fuser File 67.7 KB 0755
fusermount File 66.24 KB 4755
fusermount3 File 66.24 KB 4755
fzputtygen File 322.09 KB 0755
fzsftp File 706.54 KB 0755
g++ File 1.07 MB 0755
g++-14 File 1.07 MB 0755
galculator File 200.4 KB 0755
galera_new_cluster File 922 B 0755
galera_recovery File 3.29 KB 0755
gamma4scanimage File 66.16 KB 0755
gapplication File 66.24 KB 0755
gatttool File 130.34 KB 0755
gawk File 776.39 KB 0755
gawkbug File 6.64 KB 0755
gc File 66.51 KB 0755
gcc File 1.07 MB 0755
gcc-14 File 1.07 MB 0755
gcc-ar File 66.52 KB 0755
gcc-ar-14 File 66.52 KB 0755
gcc-nm File 66.52 KB 0755
gcc-nm-14 File 66.52 KB 0755
gcc-ranlib File 66.52 KB 0755
gcc-ranlib-14 File 66.52 KB 0755
gcore File 3.62 KB 0755
gcov File 516 KB 0755
gcov-14 File 516 KB 0755
gcov-dump File 387.93 KB 0755
gcov-dump-14 File 387.93 KB 0755
gcov-tool File 452.03 KB 0755
gcov-tool-14 File 452.03 KB 0755
gcr-viewer File 66.23 KB 0755
gcr-viewer-gtk4 File 66.23 KB 0755
gdb File 11.51 MB 0755
gdb-add-index File 4.55 KB 0755
gdbtui File 126 B 0755
gdbus File 66.25 KB 0755
gdk-pixbuf-csource File 66.2 KB 0755
gdk-pixbuf-pixdata File 66.18 KB 0755
gdk-pixbuf-thumbnailer File 66.26 KB 0755
gdm-control File 66.16 KB 0755
gdnc File 73.79 KB 0755
gdomap File 66.02 KB 0755
geany File 66.27 KB 0755
gencat File 66.23 KB 0755
genfio File 8.63 KB 0755
genisoimage File 665.81 KB 0755
geod File 66.18 KB 0755
geoiplookup File 66.16 KB 0755
geoiplookup6 File 66.16 KB 0755
geqn File 265.28 KB 0755
get-edid File 66.23 KB 0755
getcifsacl File 66.16 KB 0755
getconf File 66.16 KB 0755
geteltorito File 6.06 KB 0755
getent File 66.49 KB 0755
getfacl File 66.28 KB 0755
getfattr File 66.25 KB 0755
getkeycodes File 66.59 KB 0755
getopt File 66.32 KB 0755
gettext File 66.25 KB 0755
gettext.sh File 5.05 KB 0755
ghb File 3.16 MB 0755
ghostscript File 66.22 KB 0755
gie File 66.29 KB 0755
gio File 130.29 KB 0755
gio-querymodules File 66.17 KB 0755
git File 3.89 MB 0755
git-receive-pack File 3.89 MB 0755
git-shell File 2.22 MB 0755
git-upload-archive File 3.89 MB 0755
git-upload-pack File 3.89 MB 0755
glib-compile-schemas File 66.4 KB 0755
gmake File 327.8 KB 0755
gml2gv File 66.88 KB 0755
gnome-keyring File 66.38 KB 0755
gnome-keyring-3 File 66.38 KB 0755
gnome-keyring-daemon File 1.2 MB 0755
gnome-www-browser File 5.78 KB 0755
gnutls-cli File 202.79 KB 0755
gnutls-cli-debug File 194.77 KB 0755
gnutls-serv File 130.25 KB 0755
gp-archive File 67.11 KB 0755
gp-collect-app File 67.15 KB 0755
gp-display-html File 630.35 KB 0755
gp-display-src File 66.7 KB 0755
gp-display-text File 197.34 KB 0755
gpasswd File 134.27 KB 4755
gpg File 1.21 MB 0755
gpg-agent File 453.38 KB 0755
gpg-connect-agent File 195.16 KB 0755
gpg-mail-tube File 130.73 KB 0755
gpg-wks-client File 259.26 KB 0755
gpgconf File 199.4 KB 0755
gpgparsemail File 66.24 KB 0755
gpgsm File 649.3 KB 0755
gpgsplit File 130.48 KB 0755
gpgtar File 131.69 KB 0755
gpgv File 580.24 KB 0755
gpic File 260.19 KB 0755
gpiodetect File 66.23 KB 0755
gpioget File 66.23 KB 0755
gpioinfo File 66.23 KB 0755
gpiomon File 66.16 KB 0755
gpionotify File 66.16 KB 0755
gpioset File 66.23 KB 0755
gprof File 132.26 KB 0755
gprofng File 66.49 KB 0755
gprofng-archive File 67.11 KB 0755
gprofng-collect-app File 67.15 KB 0755
gprofng-display-html File 630.35 KB 0755
gprofng-display-src File 66.7 KB 0755
gprofng-display-text File 197.34 KB 0755
graphml2gv File 66.74 KB 0755
grep File 194.3 KB 0755
gresource File 66.17 KB 0755
grim File 66.23 KB 0755
groff File 137.39 KB 0755
grog File 18.75 KB 0755
grops File 201.78 KB 0755
grotty File 201.39 KB 0755
groups File 66.45 KB 0755
growpart File 29.19 KB 0755
gs File 66.22 KB 0755
gsbj File 350 B 0755
gsdj File 352 B 0755
gsdj500 File 352 B 0755
gsettings File 66.17 KB 0755
gslj File 353 B 0755
gslp File 350 B 0755
gsnd File 277 B 0755
gspath File 66.92 KB 0755
gstack File 2.97 KB 0755
gtbl File 194.37 KB 0755
gtf File 66.38 KB 0755
gtk-update-icon-cache File 66.4 KB 0755
gtk4-update-icon-cache File 66.4 KB 0755
gts-config File 2.69 KB 0755
gts2dxf File 66.41 KB 0755
gts2oogl File 67.61 KB 0755
gts2stl File 66.54 KB 0755
gts2xyz File 66.38 KB 0755
gtscheck File 66.49 KB 0755
gtscompare File 66.92 KB 0755
gtstemplate File 5.97 KB 0755
gui-pkinst File 66.48 KB 0755
gui-runcmd File 66.95 KB 0755
gui-updater File 66.53 KB 0755
gunzip File 2.28 KB 0755
gv2gml File 66.55 KB 0755
gv2gxl File 67.05 KB 0755
gvcolor File 76.77 KB 0755
gvgen File 66.38 KB 0755
gvmap File 600.56 KB 0755
gvmap.sh File 2.13 KB 0755
gvpack File 66.94 KB 0755
gvpr File 66.28 KB 0755
gxl2dot File 67.05 KB 0755
gxl2gv File 67.05 KB 0755
gzexe File 6.29 KB 0755
gzip File 131.66 KB 0755
h2ph File 28.15 KB 0755
h2xs File 59.51 KB 0755
handbrake File 3.16 MB 0755
handbrake-gtk File 3.16 MB 0755
hardlink File 66.41 KB 0755
hciattach File 68.3 KB 0755
hciconfig File 194.56 KB 0755
hcitool File 197.91 KB 0755
hd File 66.33 KB 0755
head File 66.46 KB 0755
helpztags File 2.46 KB 0755
hex2hcd File 66.23 KB 0755
hexdump File 66.33 KB 0755
host File 130.73 KB 0755
hostid File 66.45 KB 0755
hostname File 66.09 KB 0755
hostnamectl File 66.32 KB 0755
hp-align File 9.14 KB 0755
hp-check File 39.2 KB 0755
hp-clean File 7.05 KB 0755
hp-colorcal File 9.08 KB 0755
hp-config_usb_printer File 6.98 KB 0755
hp-doctor File 12.69 KB 0755
hp-firmware File 6.47 KB 0755
hp-info File 6.26 KB 0755
hp-levels File 6.85 KB 0755
hp-logcapture File 12.15 KB 0755
hp-makeuri File 5.6 KB 0755
hp-pkservice File 3.13 KB 0755
hp-plugin File 13.62 KB 0755
hp-probe File 7.98 KB 0755
hp-query File 4.94 KB 0755
hp-scan File 86.9 KB 0755
hp-setup File 37.25 KB 0755
hp-testpage File 5.98 KB 0755
hp-timedate File 3.31 KB 0755
htcacheclean File 66.18 KB 0755
htdbm File 66.17 KB 0755
htdigest File 66.17 KB 0755
htop File 390.13 KB 0755
htpasswd File 66.17 KB 0755
httpx File 204 B 0755
iceauth File 66.73 KB 0755
iconv File 66.27 KB 0755
id File 66.46 KB 0755
iecset File 66.24 KB 0755
infocmp File 66.24 KB 0755
infotocap File 130.28 KB 0755
innochecksum File 4.64 MB 0755
innotop File 445.72 KB 0755
inotifywait File 66.24 KB 0755
inotifywatch File 66.24 KB 0755
install File 194.5 KB 0755
instmodsh File 4.27 KB 0755
invgeod File 66.18 KB 0755
invproj File 66.27 KB 0755
ionice File 66.32 KB 0755
ip File 731.48 KB 0755
ipa_verify File 66.26 KB 0755
ipcmk File 66.39 KB 0755
ipcrm File 130.32 KB 0755
ipcs File 130.32 KB 0755
ippfind File 66.26 KB 0755
ipptool File 130.17 KB 0755
ir-ctl File 66.26 KB 0755
ischroot File 66.32 KB 0755
isodump File 199.98 KB 0755
isoinfo File 406.59 KB 0755
isovfy File 199.95 KB 0755
ispell-wrapper File 7.05 KB 0755
ivtv-ctl File 66.54 KB 0755
join File 66.5 KB 0755
journalctl File 131.05 KB 0755
json-patch-jsondiff File 1004 B 0755
json_pp File 4.9 KB 0755
jsondiff File 1004 B 0755
jsonpatch File 3.77 KB 0755
jsonpointer File 1.79 KB 0755
jsonschema File 213 B 0755
kanshi File 66.18 KB 0755
kbd_mode File 66.77 KB 0755
kbdinfo File 66.62 KB 0755
kbookmarkmerger File 66.26 KB 0755
kbuildsycoca6 File 66.1 KB 0755
kbxutil File 194.7 KB 0755
kcmshell6 File 66.55 KB 0755
kcursorgen File 66.25 KB 0755
kde-geo-uri-handler File 66.1 KB 0755
kdeconnect-app File 386.98 KB 0755
kdeconnect-cli File 392.45 KB 0755
kdeconnect-handler File 392.56 KB 0755
kdeconnect-indicator File 392.78 KB 0755
kdeconnect-settings File 66.25 KB 0755
kdeconnect-sms File 779.31 KB 0755
kdeconnectd File 66.44 KB 0755
kded6 File 130.72 KB 0755
kdenlive File 11.61 MB 0755
kdenlive_render File 130.55 KB 0755
kdtc File 5.6 KB 0755
keditbookmarks File 454.16 KB 0755
kernel-install File 66.59 KB 0755
keyctl File 66.3 KB 0755
kiconfinder5 File 66.18 KB 0755
kiconfinder6 File 66.27 KB 0755
kill File 66.23 KB 0755
killall File 67.9 KB 0755
kmod File 194.29 KB 0755
kmsblank File 66.33 KB 0755
kmsprint File 66.36 KB 0755
kmstest File 259.42 KB 0755
kpackagetool6 File 130.39 KB 0755
kquitapp6 File 66.1 KB 0755
kreadconfig5 File 66.17 KB 0755
kreadconfig6 File 66.26 KB 0755
ktelnetservice6 File 66.25 KB 0755
ktrash6 File 66.25 KB 0755
kwallet-query File 66.44 KB 0755
kwalletd6 File 581.92 KB 0755
kwriteconfig5 File 66.17 KB 0755
kwriteconfig6 File 66.26 KB 0755
l2ping File 66.17 KB 0755
l2test File 66.48 KB 0755
lab-sensible-terminal File 837 B 0755
labnag File 66.76 KB 0755
labwc File 579.05 KB 0755
labwc-pi File 391 B 0755
lame File 130.26 KB 0755
laptop-detect File 3.74 KB 0755
ld File 2.38 MB 0755
ld.bfd File 2.38 MB 0755
ld.so File 196.63 KB 0755
ldd File 5.19 KB 0755
lefty File 339.02 KB 0755
less File 275.29 KB 0755
lessecho File 66.18 KB 0755
lessfile File 8.83 KB 0755
lesskey File 66.25 KB 0755
lesspipe File 8.83 KB 0755
letsencrypt File 959 B 0755
lexgrog File 131.36 KB 0755
libcamera-bug-report File 2.96 KB 0755
libcamerify File 844 B 0755
libinput File 67.58 KB 0755
libnetcfg File 15.41 KB 0755
link File 66.45 KB 0755
linux-check-removal File 4.6 KB 0755
linux-run-hooks File 3.52 KB 0755
linux-update-symlinks File 6.38 KB 0755
linux-version File 2.67 KB 0755
linux32 File 130.58 KB 0755
linux64 File 130.58 KB 0755
ln File 130.47 KB 0755
lneato File 1.51 KB 0755
lnstat File 66.59 KB 0755
loadkeys File 259.52 KB 0755
loadunimap File 66.96 KB 0755
locale File 73.41 KB 0755
localectl File 66.3 KB 0755
localedef File 331.2 KB 0755
logger File 66.88 KB 0755
logilab-pytest File 134 B 0755
login File 130.43 KB 0755
loginctl File 66.51 KB 0755
logname File 66.45 KB 0755
logresolve File 66.18 KB 0755
look File 66.32 KB 0755
lowntfs-3g File 130.84 KB 0755
lp File 66.16 KB 0755
lp-connection-editor File 777.7 KB 0755
lpoptions File 66.24 KB 0755
lpstat File 66.45 KB 0755
ls File 194.9 KB 0755
lsar File 3.02 MB 0755
lsattr File 66.17 KB 0755
lsb_release File 2.77 KB 0755
lsblk File 322.32 KB 0755
lscpu File 194.32 KB 0755
lsinitramfs File 735 B 0755
lsipc File 130.32 KB 0755
lslocks File 130.73 KB 0755
lslogins File 130.34 KB 0755
lsmem File 130.32 KB 0755
lsmod File 194.29 KB 0755
lsns File 130.32 KB 0755
lsof File 195.9 KB 0755
lspci File 132.04 KB 0755
lspgpot File 1.06 KB 0755
lsusb File 258.27 KB 0755
lto-dump File 28.02 MB 0755
lto-dump-14 File 28.02 MB 0755
lua File 259.18 KB 0755
lua5.1 File 259.18 KB 0755
luac File 194.68 KB 0755
luac5.1 File 194.68 KB 0755
luajit File 578.95 KB 0755
lwrespawn File 135 B 0755
lxclipboard File 66.24 KB 0755
lxpanel-pi File 329.37 KB 0755
lxpanelctl-pi File 66.41 KB 0755
lxpolkit File 66.09 KB 0755
lxsession File 322.32 KB 0755
lxsession-db File 66.24 KB 0755
lxsession-default File 9 KB 0755
lxsession-default-terminal File 1019 B 0755
lxsession-logout File 66.24 KB 0755
lxsession-xdg-autostart File 66.24 KB 0755
lxtask File 66.01 KB 0755
lxterminal File 133.7 KB 0755
lynx File 1.98 MB 0755
lzcat File 130.76 KB 0755
lzcmp File 7.41 KB 0755
lzdiff File 7.41 KB 0755
lzegrep File 10.17 KB 0755
lzfgrep File 10.17 KB 0755
lzgrep File 10.17 KB 0755
lzless File 2.33 KB 0755
lzma File 130.76 KB 0755
lzmainfo File 66.24 KB 0755
lzmore File 2.18 KB 0755
mac2unix File 74.17 KB 0755
make File 327.8 KB 0755
make-first-existing-target File 4.79 KB 0755
make_strings File 75.09 KB 0755
man File 133.25 KB 0755
man-recode File 67.23 KB 0755
mandb File 195.51 KB 0755
manpath File 66.63 KB 0755
mapscrn File 66.97 KB 0755
mariadb File 5.18 MB 0755
mariadb-access File 109.46 KB 0755
mariadb-admin File 4.9 MB 0755
mariadb-analyze File 4.9 MB 0755
mariadb-binlog File 5.15 MB 0755
mariadb-check File 4.9 MB 0755
mariadb-conv File 4.64 MB 0755
mariadb-convert-table-format File 4.28 KB 0755
mariadb-dump File 5.03 MB 0755
mariadb-dumpslow File 8.19 KB 0755
mariadb-find-rows File 3.35 KB 0755
mariadb-fix-extensions File 1.31 KB 0755
mariadb-hotcopy File 34.67 KB 0755
mariadb-import File 5.02 MB 0755
mariadb-install-db File 22.35 KB 0755
mariadb-optimize File 4.9 MB 0755
mariadb-plugin File 4.64 MB 0755
mariadb-repair File 4.9 MB 0755
mariadb-report File 49.02 KB 0755
mariadb-secure-installation File 14.06 KB 0755
mariadb-service-convert File 2.45 KB 0755
mariadb-setpermission File 17.7 KB 0755
mariadb-show File 4.9 MB 0755
mariadb-slap File 4.9 MB 0755
mariadb-tzinfo-to-sql File 4.58 MB 0755
mariadb-upgrade File 5.02 MB 0755
mariadb-waitpid File 4.57 MB 0755
mariadbcheck File 4.9 MB 0755
mariadbd-multi File 26.83 KB 0755
mariadbd-safe File 30.59 KB 0755
mariadbd-safe-helper File 4.57 MB 0755
markdown-it File 221 B 0755
markdown_py File 215 B 0755
mate-polkit File 61 B 0755
mawk File 194.59 KB 0755
mcookie File 66.39 KB 0755
md5sum File 66.46 KB 0755
mdig File 66.27 KB 0755
media-ctl File 66.95 KB 0755
mediainfo File 130.72 KB 0755
melt File 66.01 KB 0755
melt-7 File 66.01 KB 0755
mencoder File 2.63 MB 0755
mesa-overlay-control.py File 5.59 KB 0755
meson File 903 B 0755
migrate-pubring-from-classic-gpg File 3 KB 0755
mingle File 472.55 KB 0755
mk_modmap File 15.78 KB 0755
mkdir File 130.45 KB 0755
mkfifo File 130.45 KB 0755
mkfontdir File 65 B 0755
mkfontscale File 67.24 KB 0755
mkisofs File 665.81 KB 0755
mknod File 130.45 KB 0755
mktemp File 66.45 KB 0755
mkvextract File 3.89 MB 0755
mkvinfo File 2.82 MB 0755
mkvmerge File 6.64 MB 0755
mkvpropedit File 3.38 MB 0755
mkzftree File 66.75 KB 0755
mm2gv File 130.84 KB 0755
modeline2fb File 4.31 KB 0755
more File 66.32 KB 0755
mount File 130.31 KB 4755
mountpoint File 66.31 KB 0755
mousepad File 66.16 KB 0755
mpeg2desc File 66.26 KB 0755
mplayer File 3.07 MB 0755
mpris-proxy File 130.43 KB 0755
msql2mysql File 1.41 KB 0755
mt File 131.48 KB 0755
mt-gnu File 131.48 KB 0755
mv File 194.48 KB 0755
mvxattr File 66.16 KB 0755
my_print_defaults File 4.58 MB 0755
myisam_ftdump File 4.89 MB 0755
myisamchk File 5.02 MB 0755
myisamlog File 4.89 MB 0755
myisampack File 4.96 MB 0755
mypy File 230 B 0755
mypyc File 213 B 0755
mysql File 5.18 MB 0755
mysql_install_db File 22.35 KB 0755
mysql_upgrade File 5.02 MB 0755
mysqladmin File 4.9 MB 0755
mysqld_safe File 30.59 KB 0755
mysqldump File 5.03 MB 0755
mytop File 72.03 KB 0755
named-checkconf File 66.23 KB 0755
named-checkzone File 66.24 KB 0755
named-compilezone File 66.24 KB 0755
named-journalprint File 66.16 KB 0755
named-nzd2nzf File 66.16 KB 0755
named-rrchecker File 66.16 KB 0755
namei File 66.32 KB 0755
nano File 324.81 KB 0755
nawk File 776.39 KB 0755
nc File 66.49 KB 0755
nc.openbsd File 66.49 KB 0755
ncdu File 130.15 KB 0755
neato File 66.43 KB 0755
neqn File 913 B 0755
net File 1.08 MB 0755
netcat File 66.49 KB 0755
netstat File 199.42 KB 0755
networkctl File 130.81 KB 0755
newgrp File 66.31 KB 4755
ngettext File 66.25 KB 0755
nhlt-dmic-info File 66.33 KB 0755
nice File 66.45 KB 0755
ninja File 323.64 KB 0755
nisdomainname File 66.09 KB 0755
nl File 66.55 KB 0755
nm File 67.93 KB 0755
nm-online File 66.16 KB 0755
nmblookup File 194.34 KB 0755
nmcli File 1.05 MB 0755
nmtui File 872.9 KB 0755
nmtui-connect File 872.9 KB 0755
nmtui-edit File 872.9 KB 0755
nmtui-hostname File 872.9 KB 0755
nohup File 66.45 KB 0755
nop File 66.41 KB 0755
normalizer File 227 B 0755
nproc File 66.45 KB 0755
nroff File 5.58 KB 0755
nsec3hash File 66.17 KB 0755
nsenter File 130.56 KB 0755
nslookup File 130.7 KB 0755
nstat File 146.43 KB 0755
nsupdate File 130.35 KB 0755
ntfs-3g File 194.88 KB 4755
ntfs-3g.probe File 66.23 KB 0755
ntfscat File 66.27 KB 0755
ntfscluster File 66.27 KB 0755
ntfscmp File 66.27 KB 0755
ntfsdecrypt File 66.28 KB 0755
ntfsfallocate File 66.27 KB 0755
ntfsfix File 66.37 KB 0755
ntfsinfo File 66.28 KB 0755
ntfsls File 67.32 KB 0755
ntfsmove File 66.27 KB 0755
ntfsrecover File 130.36 KB 0755
ntfssecaudit File 130.74 KB 0755
ntfstruncate File 66.2 KB 0755
ntfsusermap File 66.2 KB 0755
ntfswipe File 66.79 KB 0755
ntlm_auth File 130.23 KB 0755
numfmt File 130.51 KB 0755
numpy-config File 216 B 0755
nvlc File 47 B 0755
oLschema2ldif File 66.16 KB 0755
obamenu File 6.78 KB 0755
obexctl File 130.24 KB 0755
objcopy File 199.7 KB 0755
objdump File 394.74 KB 0755
obxprop File 66.16 KB 0755
ocsptool File 130.24 KB 0755
od File 130.47 KB 0755
ogg123 File 131.66 KB 0755
oggdec File 66.53 KB 0755
oggenc File 131.97 KB 0755
ogginfo File 66.26 KB 0755
open File 31.53 KB 0755
openapp File 10.69 KB 0755
openbox File 451.63 KB 0755
openbox-rpd File 76 B 0755
openbox-session File 595 B 0755
openocd File 4.16 MB 0755
openssl File 1.09 MB 0755
opentool File 5.71 KB 0755
openvt File 67.06 KB 0755
osage File 66.43 KB 0755
otpset File 5.79 KB 0755
overlaycheck File 29.76 KB 0755
ovmerge File 47.22 KB 0755
p11-kit File 258.52 KB 0755
p11tool File 387.66 KB 0755
p7zip File 4.64 KB 0755
pager File 275.29 KB 0755
pahole File 259.44 KB 0755
paper File 66.74 KB 0755
paperconf File 66.46 KB 0755
parse-edid File 73.81 KB 0755
partx File 194.32 KB 0755
passwd File 139.09 KB 4755
paste File 66.46 KB 0755
pastebinit File 18.19 KB 0755
patch File 195.45 KB 0755
patchwork File 66.43 KB 0755
pathchk File 66.45 KB 0755
pbget File 2.51 KB 0755
pbput File 2.51 KB 0755
pbputs File 2.51 KB 0755
pcilmr File 66.49 KB 0755
pcmanfm File 327.81 KB 0755
pcmanfm-pi File 145 B 0755
pcre2-config File 1.95 KB 0755
pdb3 File 88.79 KB 0755
pdb3.13 File 88.79 KB 0755
pdbedit File 66.16 KB 0755
pdf2dsc File 705 B 0755
pdf2ps File 909 B 0755
pdfattach File 66.24 KB 0755
pdfdetach File 66.32 KB 0755
pdffonts File 66.33 KB 0755
pdfimages File 66.33 KB 0755
pdfinfo File 66.34 KB 0755
pdfseparate File 66.24 KB 0755
pdfsig File 66.73 KB 0755
pdftocairo File 194.44 KB 0755
pdftohtml File 130.31 KB 0755
pdftoppm File 66.44 KB 0755
pdftops File 66.5 KB 0755
pdftotext File 66.34 KB 0755
pdfunite File 66.24 KB 0755
pdwtags File 194.88 KB 0755
pear File 793 B 0755
peardev File 814 B 0755
pecl File 727 B 0755
peekfd File 66.71 KB 0755
perl File 3.64 MB 0755
perl5.40-aarch64-linux-gnu File 66.37 KB 0755
perl5.40.1 File 3.64 MB 0755
perlbug File 44.52 KB 0755
perldoc File 125 B 0755
perlivp File 10.61 KB 0755
perlthanks File 44.52 KB 0755
perror File 4.79 MB 0755
pf2afm File 498 B 0755
pfbtopfa File 516 B 0755
pfunct File 194.82 KB 0755
pglobal File 194.88 KB 0755
pgrep File 66.32 KB 0755
pgzrun File 212 B 0755
phar File 14.88 KB 0755
phar.phar File 14.88 KB 0755
phar.phar8.4 File 14.88 KB 0755
phar8.4 File 14.88 KB 0755
phar8.4.phar File 14.88 KB 0755
php File 5.76 MB 0755
php8.4 File 5.76 MB 0755
pi-gpk-dbus-service File 196.63 KB 0755
pi-gpk-install-local-file File 131.27 KB 0755
pi-gpk-log File 131.62 KB 0755
pi-gpk-prefs File 131.59 KB 0755
pi-gpk-update-viewer File 196.95 KB 0755
pi-packages File 197.38 KB 0755
pic File 260.19 KB 0755
piclone File 66.88 KB 0755
pico File 324.81 KB 0755
piconv File 8.16 KB 0755
pidof File 66.29 KB 0755
pidwait File 66.32 KB 0755
pinctrl File 66.55 KB 0755
pinentry File 130.52 KB 0755
pinentry-curses File 130.52 KB 0755
pinentry-gnome3 File 130.52 KB 0755
pinentry-x11 File 130.52 KB 0755
ping File 208.45 KB 0755
ping4 File 208.45 KB 0755
ping6 File 208.45 KB 0755
pinky File 66.5 KB 0755
pinout File 960 B 0755
pintest File 962 B 0755
pip File 222 B 0755
pip3 File 222 B 0755
pipewire File 66.24 KB 0755
pipewire-aes67 File 66.24 KB 0755
pipewire-avb File 66.24 KB 0755
pipewire-pulse File 66.24 KB 0755
pishutdown File 66.65 KB 0755
piwiz File 131.8 KB 0755
pkaction File 66.23 KB 0755
pkcheck File 66.23 KB 0755
pkexec File 66.21 KB 4755
pkg-config File 67.96 KB 0755
pkgconf File 67.96 KB 0755
pkill File 66.32 KB 0755
pkttyagent File 66.23 KB 0755
pl File 67.5 KB 0755
pl2link File 68.54 KB 0755
pl2pm File 4.43 KB 0755
plasma-activities-cli6 File 66.17 KB 0755
play File 130.3 KB 0755
pldd File 66.15 KB 0755
pldes File 67.2 KB 0755
plget File 67.24 KB 0755
plmerge File 67.54 KB 0755
plog File 146 B 0755
plparse File 67.53 KB 0755
plser File 67.76 KB 0755
plutil File 71.54 KB 0755
plymouth File 66.79 KB 0755
pmap File 66.27 KB 0755
pod2html File 3.95 KB 0755
pod2man File 18.46 KB 0755
pod2text File 12.8 KB 0755
pod2usage File 4.01 KB 0755
podchecker File 3.64 KB 0755
poff File 2.77 KB 0755
pon File 1.33 KB 0755
ppdc File 130.38 KB 0755
ppdhtml File 130.38 KB 0755
ppdi File 130.38 KB 0755
ppdmerge File 66.24 KB 0755
ppdpo File 130.38 KB 0755
pphs File 404 B 0755
pprompt.sh File 336 B 0755
pr File 130.52 KB 0755
precat File 5.52 KB 0755
preconv File 66.37 KB 0755
prefcnt File 194.74 KB 0755
preparetips5 File 1019 B 0755
preunzip File 5.52 KB 0755
prezip File 5.52 KB 0755
prezip-bin File 66.16 KB 0755
print File 18.57 KB 0755
printafm File 395 B 0755
printenv File 66.45 KB 0755
printf File 66.45 KB 0755
prlimit File 66.82 KB 0755
procan File 131.93 KB 0755
profiles File 66.16 KB 0755
proj File 66.27 KB 0755
projinfo File 130.58 KB 0755
projsync File 130.34 KB 0755
prove File 13.36 KB 0755
proxy File 66.01 KB 0755
prtstat File 66.63 KB 0755
prune File 66.54 KB 0755
ps File 194.86 KB 0755
ps2ascii File 494 B 0755
ps2epsi File 1.27 KB 0755
ps2pdf File 272 B 0755
ps2pdf12 File 257 B 0755
ps2pdf13 File 257 B 0755
ps2pdf14 File 257 B 0755
ps2pdfwr File 1.05 KB 0755
ps2ps File 647 B 0755
ps2ps2 File 669 B 0755
ps2txt File 494 B 0755
psfaddtable File 66.59 KB 0755
psfgettable File 66.59 KB 0755
psfstriptable File 66.59 KB 0755
psfxtable File 66.59 KB 0755
psktool File 66.24 KB 0755
pslog File 66.42 KB 0755
pstree File 67.66 KB 0755
pstree.x11 File 67.66 KB 0755
ptar File 3.48 KB 0755
ptardiff File 2.58 KB 0755
ptargrep File 4.29 KB 0755
ptx File 66.5 KB 0755
pv File 133.87 KB 0755
pw-cat File 130.24 KB 0755
pw-cli File 130.34 KB 0755
pw-config File 66.24 KB 0755
pw-container File 66.24 KB 0755
pw-dot File 66.24 KB 0755
pw-dsdplay File 130.24 KB 0755
pw-dump File 130.31 KB 0755
pw-encplay File 130.24 KB 0755
pw-link File 66.24 KB 0755
pw-loopback File 66.24 KB 0755
pw-metadata File 66.24 KB 0755
pw-mididump File 66.24 KB 0755
pw-midiplay File 130.24 KB 0755
pw-midirecord File 130.24 KB 0755
pw-mon File 130.27 KB 0755
pw-play File 130.24 KB 0755
pw-profiler File 66.24 KB 0755
pw-record File 130.24 KB 0755
pw-reserve File 66.24 KB 0755
pw-top File 66.24 KB 0755
pwd File 66.45 KB 0755
pwdx File 66.23 KB 0755
pwrkey File 170 B 0755
py3clean File 7.59 KB 0755
py3compile File 12.99 KB 0755
py3versions File 12.52 KB 0755
pyav File 210 B 0755
pybabel File 956 B 0755
pybabel-python3 File 956 B 0755
pydoc File 80 B 0755
pydoc3 File 80 B 0755
pydoc3.13 File 80 B 0755
pygettext3 File 23.87 KB 0755
pygettext3.13 File 23.87 KB 0755
pygmentize File 215 B 0755
pylint File 217 B 0755
pylint-config File 233 B 0755
pyreverse File 223 B 0755
pyserial-miniterm File 975 B 0755
pyserial-ports File 969 B 0755
python File 6.36 MB 0755
python3 File 6.36 MB 0755
python3-config File 3.07 KB 0755
python3.13 File 6.36 MB 0755
python3.13-config File 3.07 KB 0755
pzstd File 706.49 KB 0755
qcam File 322.92 KB 0755
qt-faststart File 66.16 KB 0755
qt5ct File 642.33 KB 0755
qt6ct File 643.85 KB 0755
qvlc File 42 B 0755
ranlib File 67.09 KB 0755
raspi-config File 124.73 KB 0755
raspinfo File 7.51 KB 0755
rbash File 1.35 MB 0755
rctest File 66.19 KB 0755
rdma File 210.61 KB 0755
rds-ctl File 131.22 KB 0755
readelf File 779.66 KB 0755
readlink File 66.45 KB 0755
realpath File 66.46 KB 0755
rec File 130.3 KB 0755
recordmydesktop File 131.8 KB 0755
red File 89 B 0755
rename-user File 2.56 KB 0755
rename.ul File 66.31 KB 0755
renice File 66.31 KB 0755
replace File 4.57 MB 0755
reset File 66.17 KB 0755
resolve_stack_dump File 4.57 MB 0755
resolveip File 4.57 MB 0755
rev File 66.31 KB 0755
rfcomm File 66.57 KB 0755
rgrep File 30 B 0755
rm File 130.46 KB 0755
rmdir File 66.45 KB 0755
rnano File 324.81 KB 0755
rotatelogs File 66.24 KB 0755
routel File 1.62 KB 0755
rp-bookshelf File 67.38 KB 0755
rp-prefapps File 67.52 KB 0755
rpcc File 67.15 KB 0755
rpcgen File 130.91 KB 0755
rpcinfo File 66.54 KB 0755
rpi-bootloader-key-convert File 1.37 KB 0755
rpi-bootloader-version File 1.5 KB 0755
rpi-connect File 7.75 MB 0755
rpi-connect-env File 216 B 0755
rpi-connectd File 13 MB 0755
rpi-eeprom-ab File 66.39 KB 0755
rpi-eeprom-config File 25.59 KB 0755
rpi-eeprom-digest File 5.12 KB 0755
rpi-eeprom-update File 42.28 KB 0755
rpi-fw-crypto File 66.36 KB 0755
rpi-gui-nop File 386.38 KB 0755
rpi-imager File 39.24 MB 0755
rpi-keyboard-config File 1013 B 0755
rpi-keyboard-fw-update File 10.41 KB 0755
rpi-otp-private-key File 6.08 KB 0755
rpi-sign-bootcode File 14.45 KB 0755
rpi-systemd-config File 12.66 KB 0755
rpi-update File 18.33 KB 0755
rpi-usb-gadget File 11.38 KB 0755
rpicam-hello File 66.68 KB 0755
rpicam-jpeg File 131.18 KB 0755
rpicam-raw File 195.23 KB 0755
rpicam-still File 195.47 KB 0755
rpicam-vid File 195.26 KB 0755
rrsync File 12.7 KB 0755
rst-buildhtml File 12.63 KB 0755
rst2html File 220 B 0755
rst2html4 File 222 B 0755
rst2html5 File 222 B 0755
rst2latex File 222 B 0755
rst2man File 218 B 0755
rst2odt File 218 B 0755
rst2odt_prepstyles File 596 B 0755
rst2pseudoxml File 230 B 0755
rst2s5 File 216 B 0755
rst2xetex File 222 B 0755
rst2xml File 218 B 0755
rstpep2html File 678 B 0755
rsync File 594.02 KB 0755
rsync-ssl File 5.01 KB 0755
rtstat File 66.59 KB 0755
run-mailcap File 18.57 KB 0755
run-parts File 66.67 KB 0755
run-with-aspell File 57 B 0755
run0 File 130.92 KB 0755
runcon File 66.45 KB 0755
rview File 1.79 MB 0755
rvlc File 42 B 0755
samba-log-parser File 200 B 0755
samba-regedit File 131.19 KB 0755
samba-tool File 1.23 KB 0755
sane-find-scanner File 195.36 KB 0755
savelog File 10.24 KB 0755
sbout File 113 B 0755
sbtest File 186 B 0755
scalar File 2.29 MB 0755
scanimage File 67.13 KB 0755
sccmap File 66.58 KB 0755
scncopy File 66.33 KB 0755
scp File 258.56 KB 0755
scp-dbus-service File 90 B 0755
screendump File 66.53 KB 0755
script File 130.32 KB 0755
scriptlive File 66.32 KB 0755
scriptreplay File 66.32 KB 0755
scrot File 66.43 KB 0755
sdiff File 67.05 KB 0755
sdptool File 136.13 KB 0755
sed File 131.47 KB 0755
see File 18.57 KB 0755
select-default-iwrap File 474 B 0755
select-editor File 2.62 KB 0755
send2trash File 218 B 0755
sensible-browser File 1.06 KB 0755
sensible-editor File 1.51 KB 0755
sensible-pager File 824 B 0755
sensible-terminal File 1.08 KB 0755
seq File 66.45 KB 0755
sessreg File 66.48 KB 0755
setarch File 130.58 KB 0755
setcifsacl File 66.16 KB 0755
setfacl File 66.23 KB 0755
setfattr File 66.24 KB 0755
setfont File 67.22 KB 0755
setkeycodes File 66.61 KB 0755
setleds File 66.59 KB 0755
setlogcons File 66.62 KB 0755
setmetamode File 66.72 KB 0755
setpci File 66.33 KB 0755
setpriv File 130.32 KB 0755
setsid File 66.31 KB 0755
setterm File 66.32 KB 0755
setup_env File 561 B 0755
setupcon File 35.9 KB 0755
setvtrgb File 66.7 KB 0755
setxkbmap File 66.96 KB 0755
sfdp File 66.43 KB 0755
sfparse File 67.68 KB 0755
sftp File 258.54 KB 0755
sg File 66.31 KB 4755
sh File 194.59 KB 0755
sha1sum File 66.46 KB 0755
sha224sum File 66.46 KB 0755
sha256sum File 66.46 KB 0755
sha384sum File 66.46 KB 0755
sha512sum File 66.46 KB 0755
sharesec File 66.23 KB 0755
shasum File 9.75 KB 0755
showconsolefont File 66.72 KB 0755
showkey File 66.75 KB 0755
showrgb File 66.36 KB 0755
shred File 130.46 KB 0755
shuf File 66.45 KB 0755
size File 66.8 KB 0755
skill File 66.27 KB 0755
slabtop File 66.29 KB 0755
sleep File 66.45 KB 0755
slurp File 66.63 KB 0755
smb2-quota File 6.3 KB 0755
smbcontrol File 66.45 KB 0755
smbinfo File 29.47 KB 0755
smbpasswd File 66.25 KB 0755
smbstatus File 130.23 KB 0755
snice File 66.27 KB 0755
socat File 518.27 KB 0755
socat-broker.sh File 3.04 KB 0755
socat-chain.sh File 8.02 KB 0755
socat-mux.sh File 4.38 KB 0755
socat1 File 518.27 KB 0755
soelim File 66.37 KB 0755
sort File 130.71 KB 0755
sox File 130.3 KB 0755
soxi File 130.3 KB 0755
spa-acp-tool File 387.95 KB 0755
spa-inspect File 130.33 KB 0755
spa-json-dump File 66.24 KB 0755
spa-monitor File 66.33 KB 0755
spa-resample File 386.45 KB 0755
speaker-test File 66.3 KB 0755
splain File 19 KB 0755
split File 66.88 KB 0755
splitfont File 66.27 KB 0755
spumux File 196.16 KB 0755
spuunmux File 130.25 KB 0755
sq File 18.52 MB 0755
squeekboard File 16.38 MB 0755
squeekboard-restyled File 428 B 0755
sqv File 1.56 MB 0755
ss File 210.86 KB 0755
ssh File 1 MB 0755
ssh-add File 450.38 KB 0755
ssh-agent File 450.3 KB 2755
ssh-argv0 File 1.42 KB 0755
ssh-copy-id File 13.84 KB 0755
ssh-import-id File 986 B 0755
ssh-import-id-gh File 785 B 0755
ssh-import-id-lp File 785 B 0755
ssh-keygen File 578.49 KB 0755
ssh-keyscan File 578.7 KB 0755
sshfs File 132.68 KB 0755
startx File 5.26 KB 0755
startx-rpd File 657 B 0755
stat File 130.47 KB 0755
stdbuf File 66.45 KB 0755
stl2gts File 66.73 KB 0755
strace File 1.75 MB 0755
strace-log-merge File 1.83 KB 0755
streamzip File 7.87 KB 0755
strings File 66.93 KB 0755
strip File 199.71 KB 0755
stty File 130.47 KB 0755
stubgen File 211 B 0755
stubtest File 212 B 0755
su File 130.34 KB 4755
sudo File 327.31 KB 4755
sudoedit File 327.31 KB 4755
sudopwd File 66.42 KB 0755
sudoreplay File 131.83 KB 0755
sum File 66.46 KB 0755
svlc File 46 B 0755
swayidle File 66.19 KB 0755
swaylock File 132.06 KB 0755
symilar File 219 B 0755
sync File 66.45 KB 0755
syscse File 194.81 KB 0755
systemctl File 323.73 KB 0755
systemd-ac-power File 66.3 KB 0755
systemd-analyze File 259.07 KB 0755
systemd-ask-password File 66.45 KB 0755
systemd-cat File 66.31 KB 0755
systemd-cgls File 66.43 KB 0755
systemd-cgtop File 66.35 KB 0755
systemd-confext File 130.51 KB 0755
systemd-creds File 66.64 KB 0755
systemd-delta File 66.3 KB 0755
systemd-detect-virt File 66.3 KB 0755
systemd-escape File 66.3 KB 0755
systemd-firstboot File 66.74 KB 0755
systemd-hwdb File 66.3 KB 0755
systemd-id128 File 66.32 KB 0755
systemd-inhibit File 66.33 KB 0755
systemd-machine-id-setup File 66.48 KB 0755
systemd-mount File 66.65 KB 0755
systemd-notify File 66.57 KB 0755
systemd-path File 66.3 KB 0755
systemd-run File 130.92 KB 0755
systemd-socket-activate File 66.3 KB 0755
systemd-stdio-bridge File 66.31 KB 0755
systemd-sysext File 130.51 KB 0755
systemd-sysusers File 66.52 KB 0755
systemd-tmpfiles File 130.59 KB 0755
systemd-tty-ask-password-agent File 66.3 KB 0755
systemd-umount File 66.65 KB 0755
systemd-vpick File 66.52 KB 0755
systemsettings File 452.52 KB 0755
tabs File 66.16 KB 0755
tac File 66.45 KB 0755
tail File 130.48 KB 0755
tar File 463.3 KB 0755
taskset File 130.32 KB 0755
tbl File 194.37 KB 0755
tdbbackup File 66.16 KB 0755
tdbbackup.tdbtools File 66.16 KB 0755
tdbdump File 66.16 KB 0755
tdbrestore File 66.16 KB 0755
tdbtool File 66.65 KB 0755
tee File 66.46 KB 0755
tempfile File 66.41 KB 0755
test File 66.45 KB 0755
testparm File 66.21 KB 0755
thonny File 945 B 0755
tic File 130.28 KB 0755
timedatectl File 66.3 KB 0755
timeout File 66.87 KB 0755
tload File 66.25 KB 0755
toe File 66.16 KB 0755
top File 135.45 KB 0755
touch File 130.46 KB 0755
tput File 66.2 KB 0755
tqdm File 208 B 0755
tr File 66.45 KB 0755
transform File 66.92 KB 0755
tred File 66.49 KB 0755
troff File 879.8 KB 0755
true File 66.45 KB 0755
truncate File 66.45 KB 0755
trust File 258.52 KB 0755
tset File 66.17 KB 0755
tsort File 66.45 KB 0755
tty File 66.45 KB 0755
twolame File 67.13 KB 0755
twopi File 66.43 KB 0755
tzselect File 21.37 KB 0755
ucf File 35.62 KB 0755
ucfq File 18.46 KB 0755
ucfr File 9.93 KB 0755
uclampset File 130.32 KB 0755
ucs2any File 66.5 KB 0755
udevadm File 643.43 KB 0755
udisksctl File 66.23 KB 0755
ul File 66.32 KB 0755
umax_pp File 195.32 KB 0755
umount File 66.31 KB 4755
uname File 66.46 KB 0755
unar File 2.95 MB 0755
uncompress File 2.28 KB 0755
unexpand File 66.47 KB 0755
unflatten File 66.49 KB 0755
unicode_start File 2.71 KB 0755
unicode_stop File 528 B 0755
uniq File 66.48 KB 0755
unix2dos File 74.17 KB 0755
unix2mac File 74.17 KB 0755
unlink File 66.45 KB 0755
unlzma File 130.76 KB 0755
unmkinitramfs File 66.49 KB 0755
unshare File 130.53 KB 0755
unxz File 130.76 KB 0755
unzip File 195.02 KB 0755
unzipsfx File 130.84 KB 0755
unzstd File 1.26 MB 0755
update-alternatives File 66.25 KB 0755
update-desktop-database File 66.25 KB 0755
update-mime-database File 130.25 KB 0755
upower File 66.16 KB 0755
uptime File 66.23 KB 0755
usb-devices File 4.84 KB 0755
usbhid-dump File 66.24 KB 0755
usbreset File 66.16 KB 0755
userguide-open File 941 B 0755
users File 66.48 KB 0755
uuid File 66.29 KB 0755
v4l2-compliance File 771.53 KB 0755
v4l2-ctl File 524.45 KB 0755
v4l2-sysfs-path File 66.31 KB 0755
varlinkctl File 66.45 KB 0755
vcgencmd File 66.38 KB 0755
vclog File 66.55 KB 0755
vcmailbox File 66.34 KB 0755
vcs-run File 6.75 KB 0755
vcut File 66.17 KB 0755
vdir File 194.9 KB 0755
vi File 1.79 MB 0755
view File 1.79 MB 0755
vim.tiny File 1.79 MB 0755
vimdot File 1.06 KB 0755
vkcube File 387.62 KB 0755
vkcubepp File 457.55 KB 0755
vlc File 66.16 KB 0755
vlc-wrapper File 66.16 KB 0755
vmstat File 66.61 KB 0755
vncagent File 1.02 MB 0755
vncfopshelper File 824.33 KB 0755
vncinitconfig File 52.44 KB 0755
vnclicense File 1016.38 KB 0755
vnclicensewiz File 3.63 MB 0755
vncpamhelper File 720.35 KB 0755
vncpasswd File 648.23 KB 0755
vncserver File 581 B 0755
vncserver-virtual File 1.18 MB 0755
vncserver-virtuald File 3.07 MB 0755
vncserver-x11 File 1.54 MB 4755
vncserver-x11-core File 6.17 MB 0755
vncserver-x11-serviced File 624.28 KB 0755
vncserverui File 4.29 MB 0755
vorbiscomment File 66.24 KB 0755
vorbistagedit File 4.32 KB 0755
vsftpdwho File 54 B 0755
vulkaninfo File 771.27 KB 0755
w File 66.27 KB 0755
wall File 66.32 KB 0755
watch File 66.7 KB 0755
watchgnupg File 66.16 KB 0755
wayvnc File 202.07 KB 0755
wayvncctl File 69.54 KB 0755
wbinfo File 66.16 KB 0755
wc File 66.47 KB 0755
wcmgr File 65.98 KB 0755
wcurl File 10.98 KB 0755
wdctl File 130.32 KB 0755
webalizer File 212.18 KB 0755
webazolver File 212.18 KB 0755
wf-panel-pi File 711.09 KB 0755
wfpanelctl File 697 B 0755
wget File 467.16 KB 0755
whatis File 67.12 KB 0755
whereis File 66.31 KB 0755
which File 1.05 KB 0755
which.debianutils File 1.05 KB 0755
whiptail File 66.73 KB 0755
who File 66.5 KB 0755
whoami File 66.45 KB 0755
winexe File 194.25 KB 0755
wireplumber File 66.39 KB 0755
wlopm File 66.13 KB 0755
wlr-randr File 66.18 KB 0755
word-list-compress File 66.16 KB 0755
wordview File 8.97 KB 0755
wpa_passphrase File 130.25 KB 0755
wpctl File 66.44 KB 0755
wpexec File 66.3 KB 0755
wsrep_sst_backup File 2.39 KB 0755
wsrep_sst_common File 68.25 KB 0755
wsrep_sst_mariabackup File 51.98 KB 0755
wsrep_sst_mysqldump File 8.82 KB 0755
wsrep_sst_rsync File 29.85 KB 0755
wsrep_sst_rsync_wan File 29.85 KB 0755
www-browser File 1.98 MB 0755
x-session-manager File 657 B 0755
x-terminal-emulator File 133.7 KB 0755
x-window-manager File 451.63 KB 0755
x-www-browser File 848 B 0755
xarchiver File 323.38 KB 0755
xargs File 130.35 KB 0755
xauth File 67.45 KB 0755
xcmsdb File 66.57 KB 0755
xcompmgr File 66.16 KB 0755
xdg-desktop-icon File 22.29 KB 0755
xdg-desktop-menu File 43.17 KB 0755
xdg-email File 28.24 KB 0755
xdg-icon-resource File 31.47 KB 0755
xdg-mime File 46.62 KB 0755
xdg-open File 31.53 KB 0755
xdg-screensaver File 38.55 KB 0755
xdg-settings File 43.31 KB 0755
xdg-user-dir File 234 B 0755
xdg-user-dirs-update File 66.09 KB 0755
xfconf-query File 66.82 KB 0755
xgamma File 66.4 KB 0755
xhost File 66.58 KB 0755
xinit File 66.63 KB 0755
xinput File 67.41 KB 0755
xkbbell File 66.44 KB 0755
xkbcomp File 264.73 KB 0755
xkbevd File 66.73 KB 0755
xkbprint File 130.73 KB 0755
xkbvleds File 67.3 KB 0755
xkbwatch File 67.32 KB 0755
xkeystone File 16.58 KB 0755
xls2csv File 67.35 KB 0755
xml2-config File 1.4 KB 0755
xmlparse File 67.38 KB 0755
xmlstarlet File 130.11 KB 0755
xmodmap File 66.99 KB 0755
xrandr File 67.03 KB 0755
xrdb File 66.89 KB 0755
xrefresh File 66.51 KB 0755
xsel File 66.01 KB 0755
xset File 66.81 KB 0755
xsetmode File 66.38 KB 0755
xsetpointer File 66.4 KB 0755
xsetroot File 66.56 KB 0755
xsettingsd File 66.46 KB 0755
xstdcmap File 66.98 KB 0755
xsubpp File 5.05 KB 0755
xvidtune File 68.16 KB 0755
xwayland-xauth File 448 B 0755
xz File 130.76 KB 0755
xzcat File 130.76 KB 0755
xzcmp File 7.41 KB 0755
xzdiff File 7.41 KB 0755
xzegrep File 10.17 KB 0755
xzfgrep File 10.17 KB 0755
xzgrep File 10.17 KB 0755
xzless File 2.33 KB 0755
xzmore File 2.18 KB 0755
yes File 66.45 KB 0755
ypdomainname File 66.09 KB 0755
zcat File 1.93 KB 0755
zcmp File 1.64 KB 0755
zdiff File 6.3 KB 0755
zdump File 66.09 KB 0755
zegrep File 29 B 0755
zenity File 136.51 KB 0755
zenoty File 66.34 KB 0755
zfgrep File 29 B 0755
zforce File 2.03 KB 0755
zgrep File 8.01 KB 0755
zip File 264.14 KB 0755
zipcloak File 132.36 KB 0755
zipdetails File 231.06 KB 0755
zipgrep File 2.76 KB 0755
zipinfo File 195.02 KB 0755
zipnote File 132.05 KB 0755
zipsplit File 132.05 KB 0755
zless File 2.38 KB 0755
zmore File 1.79 KB 0755
znew File 4.46 KB 0755
zstd File 1.26 MB 0755
zstdcat File 1.26 MB 0755
zstdgrep File 3.78 KB 0755
zstdless File 197 B 0755
zstdmt File 1.26 MB 0755
Filemanager