__  __    __   __  _____      _            _          _____ _          _ _ 
 |  \/  |   \ \ / / |  __ \    (_)          | |        / ____| |        | | |
 | \  / |_ __\ V /  | |__) | __ ___   ____ _| |_ ___  | (___ | |__   ___| | |
 | |\/| | '__|> <   |  ___/ '__| \ \ / / _` | __/ _ \  \___ \| '_ \ / _ \ | |
 | |  | | |_ / . \  | |   | |  | |\ V / (_| | ||  __/  ____) | | | |  __/ | |
 |_|  |_|_(_)_/ \_\ |_|   |_|  |_| \_/ \__,_|\__\___| |_____/|_| |_|\___V 2.1
 if you need WebShell for Seo everyday contact me on Telegram
 Telegram Address : @jackleet
        
        
For_More_Tools: Telegram: @jackleet | Bulk Smtp support mail sender | Business Mail Collector | Mail Bouncer All Mail | Bulk Office Mail Validator | Html Letter private



Upload:

Command:

www-data@216.73.216.10: ~ $
ELF>��@h@8
@@@@��8N8NPPP%%ppp���������������PP88800hhhDDS�td88800P�td������Q�tdR�td������00/lib64/ld-linux-x86-64.so.2 GNU���GNU�jW�x>�]߃�cI;�m$��GNU� �e�m}�V�mV�,
�[��	�r���
_6v�
� 

��H)�	�Px��Z�_��

��J���y
�X
B��h��	���	5
�
	b��/�n�#�
jK
$u��
�	`
��� |��\x
� 
yc%�/��&L�;!�	:�"	�X
��
�;�X	�F���*;M
�
�
�s�
�$���
_n
PE�
��,s�	������
�	S���ts".	n
�
C
l
�3K��X#��w	2�9<	�?���_)���
B�;
�tNO-�
j��
3�J	��
6
�W, �
��R��
���
z�����J
0
���
?�,
���
�	�h#j�	l	j
�F��c�
��
X"Ug__gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__libc_start_main__cxa_finalizeg_freeg_logg_io_channel_unix_newg_io_add_watchg_io_channel_unrefg_source_remove__vsnprintf_chk__stack_chk_failg_strdupg_strdup_printfg_file_testfopen64filenodup2g_ptr_array_newg_ptr_array_addg_unlinkrenameg_ptr_array_free__errno_location__fprintf_chkg_key_file_freeg_main_loop_quitxmlSecOpenSSLShutdownxmlSecOpenSSLAppShutdownxmlSecShutdowng_get_current_timeg_hash_table_foreach_removeg_hash_table_sizereadmemmoveg_date_time_new_now_utcg_date_time_formatg_date_time_get_microsecondg_date_time_unrefstrleng_rw_lock_reader_lockfputsg_rw_lock_reader_unlockg_rw_lock_writer_lockg_rw_lock_writer_unlockfflushstderrfcloseabortwriteg_mutex_lockg_mutex_unlocksigactiong_source_newg_source_add_pollpipefcntl64g_strcmp0g_set_errorg_strndupg_realloc_ng_strchugg_strchompg_markup_parse_context_newg_markup_parse_context_freeg_markup_parse_context_parseg_error_freeg_hash_table_lookupg_mkstempfchmodrecvsendg_malloc0acceptg_markup_escape_textg_hash_table_insertsocketg_strlcpybindchownlisteng_build_filenameg_time_val_from_iso8601g_strrstrg_strstr_leng_base64_decodememcmpg_base64_encode__memcpy_chklstat64g_path_get_dirnameg_mkdir_with_parentsg_strdup_vprintf__syslog_chkg_path_is_absoluteg_find_program_in_pathg_get_current_dirfgets__isoc23_strtolkillg_source_set_callbackg_source_attachg_source_unrefsetlocalegetenvstrrchrg_filename_from_utf8g_io_channel_new_fileg_str_equalg_str_hashg_hash_table_new_fullg_io_channel_read_linememchrg_utf8_validateg_strcompressg_hash_table_unrefstrncmpopenlogg_mallocxmlSecInitxmlSecErrorsSetCallbackxmlSecCheckVersionExtxmlSecOpenSSLAppInitxmlSecOpenSSLInitg_main_loop_newg_main_loop_rung_clear_errorstrchrg_utf8_casefold__printf_chkg_dir_openg_dir_read_nameg_dir_closefdopeng_markup_printf_escapedfsyncg_get_host_namestrstrxmlSecDSigNsxmlSecNodeSignaturexmlSecFindNodexmlSecNodeKeyInfoxmlSecNodeX509DataxmlSecKeysMngrCreatexmlSecOpenSSLAppDefaultKeysMngrInitxmlSecNodeX509CertificatexmlSecKeysMngrDestroyg_malloc0_nxmlSecOpenSSLAppKeysMngrCertLoadMemoryxmlSecDSigCtxCreatexmlSecOpenSSLKeyDataX509GetKlassxmlSecPtrListAddxmlSecDSigCtxVerifyxmlSecDSigCtxDestroyg_list_freeg_list_appendg_list_removeg_list_lengthg_hash_table_remove__read_chkg_timeout_add_secondsg_vsnprintfstrerror_rg_once_implgetpwnam_rgetpwuid_rstrcspng_assertion_message_exprg_mutex_initconnect__recv_chkg_key_file_newg_key_file_load_from_fileflockforkwaitpidsetitimersigfillsetsysconfgetrlimit64sigprocmasksetsidchdirumaskgetpidg_snprintfftruncate64execv_exitsetrlimit64memcpyfstat64__realpath_chkg_key_file_get_booleang_key_file_get_integerg_key_file_get_stringg_rw_lock_initg_log_set_default_handlerg_ascii_strcasecmpg_key_file_get_groupsg_key_file_get_keysg_key_file_get_valueg_strfreevg_strerrorxmlFileMatchxmlFileClosexmlLoadCatalogxmlSchemaParsexmlNodeGetContentxmlStrEqualxmlSchemaSetParserErrorsxmlCheckVersionxmlSetGenericErrorFuncxmlAddIDxmlURIUnescapeStringxmlSchemaFreeValidCtxtxmlSchemaSetValidErrorsxmlSchemaFreeParserCtxtxmlFreeDocxmlSchemaValidateDocxmlFileReadxmlRegisterInputCallbacksxmlDocGetRootElementxmlSchemaFreexmlFreexmlFileOpenxmlGetIDxmlNodeListGetStringxmlInitParserxmlSchemaNewValidCtxtxmlHasPropxmlSchemaNewParserCtxtxmlReadMemoryOPENSSL_init_sslX509_STORE_CTX_initOPENSSL_sk_numERR_get_error_allOPENSSL_init_cryptoX509_STORE_newX509_verify_cert_error_stringBIO_s_memX509_STORE_freeX509_get_subject_nameX509_freeOPENSSL_sk_new_nullOPENSSL_sk_pushBIO_freePEM_read_bio_X509BIO_new_mem_bufX509_NAME_onelineX509_NAME_cmpX509_get_issuer_nameX509_STORE_CTX_newX509_STORE_CTX_get_current_certX509_printBIO_newX509_STORE_set_verify_cbBIO_ctrlOPENSSL_sk_pop_freeX509_STORE_CTX_freeX509_STORE_CTX_set0_trusted_stackX509_STORE_CTX_get_errorERR_error_stringX509_STORE_CTX_get_error_depthX509_verify_certlibglib-2.0.so.0libxmlsec1-openssl.so.1libxmlsec1.so.1libxml2.so.2libssl.so.3libcrypto.so.3libc.so.6OPENSSL_3.0.0GLIBC_2.34GLIBC_2.38GLIBC_2.33GLIBC_2.4GLIBC_2.3.4GLIBC_2.28GLIBC_2.14GLIBC_2.2.5LIBXML2_2.6.0LIBXML2_2.5.8LIBXML2_2.4.30		

	


	
5  +pZP����h���
s���~ii

�ti		���������ui	�A  +pZ(���������L�������@���΁��݁����(���8��H��X�'�h�6�x�C�������0��� ���а��`���@�@��H�P��X��Х�Щ�����P�X�`�(h�p�2x�R��X��Y��u��x��y������������������P�X�`�h�p�x�������	��
������
���������������� �(�0�8�@� H�!P�"X�#`�$h�%p�&x�'��)��*��+��,��-��.��/��0��1�3�4�5�6�7�8��9�:�;�<�= �>(�?0�@8�A@�BH�CP�DX�E`�Fh�Gp�Hx�I��J��K��L��M��N��O��P��Q��S�T�U�V�W�Z�[��\�]�^�_�` �a(�b0�c8�d@�eH�fP�gX�h`�ih�jp�kx�l��m��n��o��p��q��r��s��t��v�w�z�{�|�}�~���������� ��(��0��8��@��H��P��X��`��h��p��x���������������������������������������������������� ��(��0��8��@��H��P��X��`��h��p��x���������������������������������������������������� ��(��0��8��@��H��P��X��`��h��p��x���������������������������������������������������� ��(��0��8��@��H��P��X��`��h��p��x�����������������������������������������	�
 �(�0�
8�@�H���H��H�i�H��t��H����5��%�@��h���f���h����f���h����f���h���f���h���f���h���f���h���f���h�r���f���h�b���f���h	�R���f���h
�B���f���h�2���f���h�"���f���h
����f���h����f���h��f���h���f���h����f���h����f���h���f���h���f���h���f���h���f���h�r���f���h�b���f���h�R���f���h�B���f���h�2���f���h�"���f���h����f���h����f���h��f���h ���f���h!����f���h"����f���h#���f���h$���f���h%���f���h&���f���h'�r���f���h(�b���f���h)�R���f���h*�B���f���h+�2���f���h,�"���f���h-����f���h.����f���h/��f���h0���f���h1����f���h2����f���h3���f���h4���f���h5���f���h6���f���h7�r���f���h8�b���f���h9�R���f���h:�B���f���h;�2���f���h<�"���f���h=����f���h>����f���h?��f���h@���f���hA����f���hB����f���hC���f���hD���f���hE���f���hF���f���hG�r���f���hH�b���f���hI�R���f���hJ�B���f���hK�2���f���hL�"���f���hM����f���hN����f���hO��f���hP���f���hQ����f���hR����f���hS���f���hT���f���hU���f���hV���f���hW�r���f���hX�b���f���hY�R���f���hZ�B���f���h[�2���f���h\�"���f���h]����f���h^����f���h_��f���h`���f���ha����f���hb����f���hc���f���hd���f���he���f���hf���f���hg�r���f���hh�b���f���hi�R���f���hj�B���f���hk�2���f���hl�"���f���hm����f���hn����f���ho��f���hp���f���hq����f���hr����f���hs���f���ht���f���hu���f���hv���f���hw�r���f���hx�b���f���hy�R���f���hz�B���f���h{�2���f���h|�"���f���h}����f���h~����f���h��f���h����f���h�����f���h�����f���h����f���h����f���h����f���h����f���h��r���f���h��b���f���h��R���f���h��B���f���h��2���f���h��"���f���h�����f���h�����f���h���f���h����f���h�����f���h�����f���h����f���h����f���h����f���h����f���h��r���f���h��b���f���h��R���f���h��B���f���h��2���f���h��"���f���h�����f���h�����f���h���f���h����f���h�����f���h�����f���h����f���h����f���h����f���h����f���h��r���f���h��b���f���h��R���f���h��B���f���h��2���f���h��"���f���h�����f���h�����f���h����f���h����f���h����f���h����f���h���f���h���f���h���f���h���f���h��r�f���h��b�f���h��R�f���h��B�f���h��2�f���h��"�f���h���f���h���f���h����f���h����f���h����f���h����f���h���f���h���f���h���f���h���f���h��r�f���h��b�f���h��R�f���h��B�f���h��2�f���h��"�f���h���f���h���f���h����f���h����f���h����f���h����f���h���f���h���f���h���f���h���f���h��r�f���h��b�f���h��R�f���h��B�f���h��2�f���h��"�f���h���f���h���f���h����f���h����f���h����f���h����f���h���f���h���f���h���f���h���f���h��r�f���h��b�f���h��R�f���h��B�f���h��2�f���h��"�f���h���f���h���f���h����f���h����f���h����f���h����f���h���f���h���f���h���f���h���f���h��r�f���h��b�f���h��R�f���h��B�f���h��2�f���h��"�f���h���f���h���f���h����f����%�fD���%�fD���%~�fD���%�fD���%ޖfD���%֖fD���%ΖfD���%ƖfD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%~�fD���%v�fD���%n�fD���%f�fD���%^�fD���%V�fD���%N�fD���%F�fD���%>�fD���%6�fD���%.�fD���%&�fD���%�fD���%�fD���%�fD���%�fD���%��fD���%��fD���%�fD���%�fD���%ޕfD���%֕fD���%ΕfD���%ƕfD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%~�fD���%v�fD���%n�fD���%f�fD���%^�fD���%V�fD���%N�fD���%F�fD���%>�fD���%6�fD���%.�fD���%&�fD���%�fD���%�fD���%�fD���%�fD���%��fD���%��fD���%�fD���%�fD���%ޔfD���%֔fD���%ΔfD���%ƔfD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%~�fD���%v�fD���%n�fD���%f�fD���%^�fD���%V�fD���%N�fD���%F�fD���%>�fD���%6�fD���%.�fD���%&�fD���%�fD���%�fD���%�fD���%�fD���%��fD���%��fD���%�fD���%�fD���%ޓfD���%֓fD���%ΓfD���%ƓfD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%~�fD���%v�fD���%n�fD���%f�fD���%^�fD���%V�fD���%N�fD���%F�fD���%>�fD���%6�fD���%.�fD���%&�fD���%�fD���%�fD���%�fD���%�fD���%��fD���%��fD���%�fD���%�fD���%ޒfD���%֒fD���%ΒfD���%ƒfD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%~�fD���%v�fD���%n�fD���%f�fD���%^�fD���%V�fD���%N�fD���%F�fD���%>�fD���%6�fD���%.�fD���%&�fD���%�fD���%�fD���%�fD���%�fD���%��fD���%��fD���%�fD���%�fD���%ޑfD���%֑fD���%ΑfD���%ƑfD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%~�fD���%v�fD���%n�fD���%f�fD���%^�fD���%V�fD���%N�fD���%F�fD���%>�fD���%6�fD���%.�fD���%&�fD���%�fD���%�fD���%�fD���%�fD���%��fD���%��fD���%�fD���%�fD���%ސfD���%֐fD���%ΐfD���%ƐfD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%~�fD���%v�fD���%n�fD���%f�fD���%^�fD���%V�fD���%N�fD���%F�fD���%>�fD���%6�fD���%.�fD���%&�fD���%�fD���%�fD���%�fD���%�fD���%��fD���%��fD���%�fD���%�fD���%ޏfD���%֏fD���%ΏfD���%ƏfD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%��fD���%~�fD���%v�fD���%n�fD���%f�fD���%^�fD���%V�fD���%N�fD���%F�fD���%>�fD���%6�fD���%.�fD���%&�fD���%�fD���%�fD���%�fD���%�fD���%��fD���%��fD���%�fD���f.����UH��AWAVAUA��ATSH��H���dH�%(H�E�1���H�G�H�;��H�;��u_���I��H��tH�3H��������u*��L��I���\�H�3L��1�1���L��I���B�L�����L��H����+�����H���A����H�{H�5��c�������L�%t=H�5tL���u���H��H����L�e�H�¾ L�����H����L��
1��-���I��A�����5L�5��1�1�L��H�]=����D���C���A���K���D�E����
E��L��A����
H��=�1�1��Z���H���R������H�{H�5��z�������1��{��L�%?(��11�1�H�5YH��H�����1�H�����H�����11�1�L��H��H�����1�H���\���H�����11�1�L��H��H�����1�H���.���H���V��\11�1�L��H��H���Z���1�H������H���(�H���H�?H�5AH�8�F�H�
EH�P�����H���H�5IH�8��H�5�	�H��8����4����o�H�=(H���������H��H�������H�
D,H��<1�H��@���I����1���L��@�����1�1�H�
.,H��M��L�-�L�%���L�
�L��1�APL��L��M��AUH��8���L�����H��H��P���I���b�AYAZ��uF�.L�����H��t4�L����L��I��M��QH��H��1�AUH��8�����H��P���^_L��P����L������uWL��@����_L�����H��t>�L����H��M��H��PH��L�
�L��PH��8���1��N�H��P���XZH��P���E1�E1�1�1�H��L�}����H��H����H�E�H�5��H��H��H��x������I�ؾ�1�H�
�*H�~;I��1���H�����H�E�H���|
H�(�H��L�=R&H�K"H��0���H��H��H��H�� ���H��H��(�����H��H���H�E�H��X���H�E�H��`���H�E�H��h���f�L��x���H��X���L��H��`���H��h�����H�E�H����L�e�M���?H�E�L�u�L�8
��M����L��
L��M��2�L��H��ID�L)�H�����I��H����A�L��E�4�H��E��t"f��GH��E�$�H��E��u�D�H��E������JH��D��H��E��u�E��E���H��@�qH��H��A�4���u�<=uH9�u`L���D�H�}��;�����fD�
H�E�H;E�s	H�U��DL�e�L�u�M�������H�5�H�=�������L�a�IA�<�H��t f.�A�L$I��E�4�H��E��u�<"�xA�$H�5&L��M��<�t.f.��HH��D��E��u�I���f.�H���0E��E��u�@��t
@��#����H��L��p���H)�L������8�H�����L��I��L)��#�L��p���H��I����L����H�}���M�������1�H�����L���������1�H�����L��������lL���L�L��H��p�����H��p���H��H���L�����"���H�M�H�O81�1����1��r�H�}��i�L����H��H����5���H��@����H�5U	������wH��P����)�H��@�����H��8������P�H�=f��������H���1�� �ņ1���1��=���M�H�
��H�%�1�H�5������"���H�58�"H��H��H��H�2��H�5{�H�8��H��H��H�5p���H��H�8���H��I��H����9�I�D��8/u�� 1�1�L��H��7�4�H����H�=m���;�����H�T���H���������	��H��1�H�
"H��H��0���H��H��H��(�����1�� H�̈��1������~��Q��1�H�5k���H�
��H�ЄH�5aH�=z��5��N��������
H�=���'��������	1��&�����Y����|H�};1�L�%<%PH��1�A�j'A�L�� ����L��H��1�A�'A����H�H�:�H���H�LH����H�=��ZYtH�
���H�=��H�����H�Z�H��0���H�
CH��(���H��H�� ������H�W�H���QH����H�l�H�5z�H�8���ƒ����D���1��vH��H�
N;H�=/$��H�=��t��H��H�=A���H�� ���H��0���H��(���H���O�H���H�����X����!H����C4�P����&�H�5�0�!H��H�C���H�{�root�@H�C��H��k�q�C,�����V����1�H���GH�����H���QH����
1�1���H�r�� 1�H��1���H�=��G�H�
@#1�1�H�N�� ��1�H�U�dH+%(��H�e�[A\A]A^A_]����ӂ��VH�5��H�=�H��p�����L��p����"���A�<��������L������a�L�����H��H��H���I��H�L������L�H�8I������H��H��H�VGAuthSeH�H�ServiceH�FI�}��L�����9���H������H�{H�5�������1�����-�H�;H��/H��f�-s�@H�C���������H�
"H����1��������H�E7�1�1���H�
�!H��7�1�1������L��8���� 1�1�L��@���H�
�H��1���Z���H��/��1�1���H����1��[�L�@1���1�H��P���H����k�H��x����_����A�L$H�5�M�T$M�у<�H��t@A�II��D�$�H��E��u�<"�����I�AM������1��3�H��H�������.H��H��@�����H��� ����L��6H�
���H��H�=0 ���H�
d H��7���H����1������H�=�������tH�=���z��A�ƅ��H��H�=�3A���1�H��H��1��SH��x���H�u��:H��P���H����D�m�H�]�E����E1�D��0���D��`���D��@�����`���9�@����JH�{H�U�H�u���7H��P���H����L�e�E1��U�1�L��I��L��A9D$��H��H��I\$���oHc�H��8���I��Lk�H��H���H��x���I��I��M9��-I�7I�<$�WL��t�A�~�L��X���E1�M���I�WK�DmH�{H�‹L�@9����tuL��x���L��E1�Lk�H���H��x���A��L��M�H��H���L
L9�u�L��H��x���D��x��������x���������`���H�� ���H�����L��p�����H��p���H�����I�����L��H��H��h�����L�牅p������H��h��������p������(���I��E9o�����M��L��X������L�CH�
�1�1�H��1�����H���I��L��I�̅���L�����A�>H�L�
�uM�NL�CATH�
q1�PH��1�1���A]A^���D��0���HcE�H�]���~ H��I��L�$@L��I�� �T	M9�u�H���'��E���EH�|��H������x'H��P����!����dH��8���H�M��U�H���i�����I��A��1�V�H�
��H��)P1����1�H�
�1�H��1���_AXH�
kH��1���L�H3H�
���H��H�=�����L��H�>,1�1���`�L���8��L���0������H�f��1�1��4��0���1�H�
��1�H� 3��H���;8�[�����A��1�H�21������z���H�{H�5s��
���txH�
��1�1�H������z���H�5��H�=r2��r���L�@H��P���1�1�H��*��h�H��x����\�H�}��3�����H�H�5����J�H�=k)��H�=�)��H�=����H�=�)��H�=*����n���H�5:zH�=��1����L�%%zH��H��L���������'H�������H�� ���H��0���H�
_�H��(����S��I�E���H�
��1�1�H����n�����/�f�CH��@�������H��/�1�1��7��3���H�=syE1�1ɺ�H�5���uIH����H�=MyH�U�1�L�=�����I��H���!D��p����L�����I��H�����H�5�L������unC�|5�.xmlucL����H�5)�L�hI��L���u��H�����L���aE1�1ɺ�H��H��I���HH���,L���(��L��� ��H�����L���`�I��H����H�5exL��1�L������L��H�=��H���>�������E1�1ɺ�H��H�5~��=HH��t�H�=Q*��H��1�H��1��=LH��H�=��1��l��H��H��I�������x0u[H�=�+���L��H�ڿH��1��KL���O���*����%��M��I��R�H�
@1�H�+P1��?��Y^H�=&+��L��H��1�H��1��KL�����H������L����H�
0�1�1�H��+�����4�����H���1�1�����������M��1�AQ�I��H�
�H�n*P1����AZA[L�%�vH�=�+���1�H��H��L��1��JH���M�����L��D��p�������-���H��vH�=�'A���1�H��H��H��1��J����H�=M)�h�L��H��1�H��1��JL������L�������4����yH�5*�H�=��H��h����B�H��h����J���H�E�L�v1�H�
bH�(�L�H1����H�}��������8���.H�5��H�=������H�5���H�=���üH��p����'��H�}����M��H�5������xH�=��荼�����M��1�D�H�
GH��#1�������H�
�H�N-���Hc�1�H��H���������1�I��^H��H���PTE1�1�H�=���t�f.�H�=�tH��tH9�tH�fsH��t	�����H�=�tH�5�tH)�H��H��?H��H�H�tH��sH��t��fD�����=utu+UH�=sH��tH�=�s�����d����Mt]������w�����������1����HcO`H��H��H�ktD��H��tH�����f�1��ff.�f����ff.�UH��AUI��ATSH��H�?�8��A�E��~61�fDI�EL�$[H��I��J�| ���I�EJ�| ���A9]�I�}H��[A\A]]�����UH��ATI��SH�?����A�L$I�|$��~<1��@H��A9\$~)H��H��H����u�H�xH�����I�|$A9\$����I�|$[A\]�q�����
��H�`���Hc�H�>��@H����H�����H�����H�����H�C���H����H����H�����H�����H�����H����H������UH��ATSH��H�?���H�{���L�cM��t%I�<$�o��I�|$�e��I�|$�[��L���S��H��[A\]�G���H����UH��SH��H��D�GA��
��H�B�Jc�H�>��@H����H��H�]������f�H�����H�{����H��H�]�������H�����H�{ ���H�{0���H�{8����f.�H����H�{���H�{(����H��w��H�{�n��H�{8�e��H�{@�\��H�{(�S���O���fD�H�
��1�1�H�(�K���'���fD��UH�q�L�5H��AWA��AVI��AUI��ATM��SH��H��M���uI��LD�H��AQH��HD�D�M�L��A��AT�1�1�S����H���uD�U�L��I��E��L��ARL��L�޿AT1�艸H�� H�e�[A\A]A^A_]�fD��UH��ATSH���,����H�پH��0H��I�����L��C(����[1�A\]�ff.���UH��SH��H���(��u	H�]�1��Ð�����C(1�H�]���ff.����UH��SH��H��H�����;w �H��Hc�H�>����H�]���@�H�]���@�H�]���@�H�]���@H�]��RH�5��H�=����۵�H�]���@�;H�5��H�=��谵�T���ff.���UH��SH��H��H��t{�;w�H�i�Hc�H�>���H�]���@�H�]���@�H�]���@H�]���H�5�H�="���#��H�]���@��H�5��H�=����h���U�,H�5��H��SH���H��H��H��mH�8��H�
K�H��1�A����l� 1��-��H��mH��1�H�5��H�8��H�]���m��fDU�H�T�H�5}�H��SH��H�mmH�8����l��~{H�d�A����1�H��H��1�����Wl��	~>Lc���Mi�gfffI��"A)�D���yoH��H�]�1��H�h��1��d��@�A�����A�1��H��
1��3�����k�T���ff.�@U��QH���H�5��H��SH��H�}lH�8����k��~{H�D�A����1�H��H�01�����ck��	~>Lc���Mi�gfffI��"A)�D����nH��H�]�1��H�x
��1��t��@�A�����A��Q1��H�r
1��C����Q��j�Q�T���ff.�@��UH��ATSH���H��P���H��X���L��`���L��h�����t#)�p���)M�)U�)]�)e�)m�)u�)}�dH�%(H��8���1�H��0���H�EI��H�����L������H��H��@�����Dž���L�%�H�� ���Dž���0����1�1�L��H���I��1�H��L����H��8���dH+%(uH���[A\]�����@��UI��H����1�H��AVL�5�AUL��ATI��1�S����1�1�L������H��tKH��I��1�1�L��H��������H������H��I��H�i�M��t[L��A\A]A^]�DM��L��1�E1�H�(��1��b��[L��A\A]A^]�fDUH��ATI��S�H��H��F��H�CI�|$�8��H�C[A\]�ff.�@���ff.�UH��AWAVAUATSH��H��dH�%(H�E�1�H����H�s1�H�=��1��}���H��I�����������C$H�5������L�������L��H���������L���K��H��tH����������������H�E�dH+%(�CH�ĸH��[A\A]A^A_]ÐH��0���L���A�������K$�����i���S E1�I�Ņ�u�Hf.�A��D;{ s4H�sD��H�=��1����L��I��H���c���L��������u�A�U�Ѓ�������H)�L�$�H��H�� ����<fD�L�������tL���'����uHH��(���L��I�����I���tEI�EH�� ����H�J� N�<"H��(���L���/����t�H��(���I������I���u�A�E��t$E1�f.�I�EJ�<�I�����E;er�L�����1��C�C$H�5������@�[��H�
��H���1�D��1��|�������H�
��H�	H��1���C������fDHcCH;C�<������DH��`����C�K$��������f��IH�5��H�=���h��"������ff.���UH��� 1�1�H��SH�����H�GfH�;���H�{���H���~��H�
��1�1�H���� ���H�=�h���H�=hH��t�E��1�H�lhH�=]hH��t�k��1�H�Jh��������s��H���1�1�� ����H�X�1�H�5]���1���d������UH��ATI��SH�}�H�� ��ddH�%(H�E�1��P��I\$@1�H;]�|H�U�dH+%(u2H�� [A\]�M�D$H�
\�H��1����y�������ff.�f���UH��ATI��SH�}�H�� ��cdH�%(H�E�1����I\$ H;]���H�U�dH+%(uH�� ��[A\]����@��UH�=g1�H�5����H�����H�=�f�7��]��������f����UH�=�f1�H�5����H���C��H�=�f���]��������f����UH��ATL�%/dSH��H��dH�%(H�E�1���du<HcC`A��������H�U�dH+%(�PH�Đ[A\]�f.��=rdH��`������	��H�����H=���Hc�`�����@��fo�`���fo�p���L�%|cfoU�fo]�foe�fom�efou�fo}�
e!e*e%3e-<e5Ee=Ne��@wADŽ��1�f��c�����aH�5��H�=��蘩Hc�`�����@�E����bH�5o�H�=���p�Hc�`����!���@H�!�1�1������������UH��AUI��ATA��S��H��9�7A�D$D)�H��H�Hc�H�@H�[[A\H��H��I�tI�|�A]]������
H�5��H�=��ب�fDUH��AUI��ATA��S��H��9�7A�D$D)�H��H�Hc�[A\H��H��I�tI�|�A]]���f���
H�5I�H�=���h��fD��U��H��AWAVAUATS��H��(#�`u���?H��([A\A]A^A_]��H��H���I��I��LD�H��I��H�>�L�5U�LD���� t3��L�5)���t!L�5&���t��L�5-�H��LD��B��H����H��H�5�H�E��F��H�M�H��H�E�H����H�M�����H�u�H�=��Hc��Hi��MbH��&)�1����H�}�H�E�跿��H�}�����H�E�H�5��H��HE�L��H�=��1�M��L���e���H�}�I���y���M��tL���l��A�|�
uA�D�M�l$0L���!��A�t$(����I�4$H����L���?����xkI�|$��L������AD$IcD$I;D$��L�����L������A�D$(��uI�<$tIcD$I;D$��L���h��L�����L���x��L��谾�����L�5D���@�q���=�L�5��H�z�LD��U���@I�|$t�L���(��L��耿��I�<$tQL������L�����A�T$(��u�I�4$�����I�<$�����b���f�H�E�H�5��p���@A�L$(��u�L������I�$H��u�H�G]I�L$A�D$(H���H�81������e���I�<$����L��A�D$$���I�$H������H��\I�L$A�D$(H����H�81��|�������=<]�z�����B�����1�H�5G�H�}����ff.���UH��ATSH��dH�%(H�E�1���@!��H�����=�]�����H���t)H�E�dH+%(��H�Đ[A\]�f.�����8I�ă�t)���E�$�پI��H�W1�1�����@1�H��1������H�5��H�=�����m���fDH��H��h���HDžd���H�E�H��`����H���`����������@UH��AUATA��SH����	�L�-�\H��\L��������\��tqL���߽��Ic�L�h,������u"1�H�5�\D���L�����B���hH�=�[���H�5]D�``H��H���T��H��H��[A\A]]�1��GH���H�H�{�����t�=)\1�������yq�8H�5��H�=��訢f��\	��[�w\��\H����H��[��[�����0H�5S�H�=���T������=�[1����h�����y��o����z��1ۋ8����H����1�H��1��������@��UH��AUM��ATI��SH��E�HA��wCH���D��L��Hc�H�>���H�5�L���������f�D�KH��M��L��[H�
-�A\�A]1�]锽��@H�5�L���1����u��CH��[A\A]]�H�57�L���	����u��CH��[A\A]]�H�5q�L��������um�CH��[A\A]]�H�5��L����������CH��[A\A]]��H�5C�L�������uu�CH��[A\A]]�H�5�L���a�������C�C���������C0�����H�5C�L���!����uE�C����H�5��L�������������C����D�C	���@H�5��L��������uX�C���f�H�5S�L��������)����C
�g���D�C(�V���@A�����H�5��L���^����u�C�(���H�5��L���?����u�C�	���H�5b�L��� ����u�C���H�5Q�L�������u�C����H�5:�L�������u�C
���H�5�L��������u�C���H�5�L�������u�C�n���H�5��L�������u�C�O���H�5��L���f�����u�C�0���H�5��L���G������W���H�5��L���0������K���H�5��L��������u�C���H�5��L�������������{�C�i����C ���D��D�BH��A����H�
<�D��Hc�H�>����B��t(�����B���B���B	��D�BA��t�A�����B�@��B�f�D�BA�@���v�H�
\���1��[���U��1�H�
��H���?����yH�5��]H�=���fD���W���H�
0���1�����H�
����1������UH��H��H��AWAVAUM��ATSH��H���
���D�KI��A����H�2�D��Hc�H�>��DD�CA����H�
s���L��1��d���H��L��[A\A]A^A_]鞴��fDD�CH�
�A��
u�1��
L������������C$��
1�L���پ���C�@D�CA���"A����A����H�{8upL�c8�C0��D�CA���2A����A���^�C0H�C8�&���f.�D�CA���H�{�?M��H�
����L��1��I������@D�CA����H�{u�L�c�f�D�CH�
U�A��
t����f.�D�CH�
�A���s���H�{(�y���L�c(��D�CH�
%�A��
�C���1��
L���|����������C �8���@D�CH�
M�A������H�5��L���$����¸�����C ���DD�CA������A��	����H�
�����@D�CA����A�����H�
"����@D�CA���JA��� H�{@�~���L�c@�@D�CH�
��A���K����
1�L��脼���C�H���@D�CA��
�RH�{�D��Hc�H�>��fDD�KL�=mEE1�M��H�
�E�������I�7L��������
A��I��A��
u��C����L�cE1����@��H�5��H�=�������1��
L��蹻���������C�t����H�{0�^���L�c0�C(��H�{8�>���L�c8�x���@H�{ �&���L�c �`���@�C(H�C0����@H�
�����@H�
�����@H�
������@Mc�H�DI��B�0�C��������C ���fD�C H�C(���@H�{(�~���L�c(�C ���DH�
���L���H�5,�L���e����¸���A���H�5�L���G����¸���#���H�5��L���)����¸������M��H�
H�L��1����L�������H�
Y����H�
�������UH��AUM��ATI��SL��H��M����D�A��w7H��D��Hc�H�>��H�5��L��聹�����)f�D�H��M��L��[H�
.�A\�A]1�]镲��DH�5��L���1��������H��[A\A]]��H�5��L��������u��H��[A\A]]�@H�5��L���ٸ�����A����H��[A\A]]�H�5��L��豸�����9����CH�{��p�sHc����HcSH�CH�RH�D��HcCH�{H�@H���@�HcCL�CH�@I��H�@������H�5��L���1����������HcC�H�@H�CH�D���HH�xD�aD�`Mc�L���c���K�df�H�T�������BHcSH�sH�RH��H�B�����nH�5��H�=ɽ�ؔ���H�58�L��葷����uMHcC�H�@H�CH�T��HcBH�JH�@H���@��7���f.���"���DH�5�L���1��������������ff.���UH��AUM��ATI��SL��H��M���D�A������E���1H�5�L���¶�����-�CH�{� �p�sHc�����HcSH�CH��H�D�HcCH��HCH�@�HcCH��HC�@�HcCH��HCH�@��H��[A\A]]��A����H�5��L����������E1�HcCH�SH��H�D��HD�aD�`HcCMc�L��I��H��HCH�x��>���J�T �D�*H�BHcSH��HSH�B�H��[A\A]]�H�5��L��葵����tUD�H��M��L��[H�
K�A\�A]1�]鲮��f�H�5A�L���Q�����u-�H��[A\A]]�@�H��[A\A]]��H�5,�L��������uU���DH�5��L������u]�A�����@�1H�5ѺH�=�������H�5ڼL��詴����������d���fDD�L��M��H�
X���1�A�����蹭���V���@��UH��AVI��AUM��ATI��SH��H���L��L���ѭ��D�I��A����A��tSA��u9HcCH�SH�@H��H�x���M��H�
x�L��1����,���[L��A\A]A^]�l���@HcCH�@H�CH�D��L�pM�����@��H�H�@I��H�xtSD��fDHcCH�@H�CH�D��L�pM�����@��H�H�@I��H�xu�L�`�E1��e����L�`��f.���H�5)�H�=9��H�����L������H��HcCH�@H�CH�\���_���H��f.��H�5ٸH�=��HcCH�@H�CH�D������f��
H�5��H�=���ȏHcCH�@H�CH�D������f���UH��AVM��AUI��ATI��SH��H����L��L����D�I��I��A��trA��tLA��u2HcCH��HCH�x�����L��1�H�
���T���[L��A\A]A^]锧��@HcCH�SH��H�D�H�xu�L�@�Gf�HcCH�SH��H�T�HcBH�RH��H�T�H�zu�L�BHcSH��HSH�R��D�E1�������H�5y�H�=��蘎����L���h���H�SH��HcCH��H�\�说��H��f.�U1�H��AWAVI��H�=<;AUI��ATI��SH��XdH�%(H�E�1��1�H�H�U�H�E�H�E�H�E�H�E�趩��L��H�E��j��H�5�FL��H�ǺH��I��H�=��1�����L��H���&����H���Y�����uU�E�A�EH�E�I�$E1�H�}��Z���H����H�}����H�E�dH+%(��H��XL��[A\A]A^A_]�@H�M�H�U�L��H����H��u�H�U�H�u�H�M�H�}��ӯ�����v���H�E�I��H�
]�1�H����L�H1�脭��H�}��k���HcE�L�u���~ H�@M��M�,�@L��I������M9�u�L��A��!�����������UH��AUI��ATI��SH��H���H�踈��tTL��L��H������I��H��uH��L��[A\A]]�I��1�H�
d�1�H�������H��L��[A\A]]�I�ؾ1�A�H�
)�H��荬��H��L��[A\A]]�ff.�@U1�H��AWAVH�U�AUI��ATI��SH��HdH�%(H�E�1��H�=W8H�1�H�E�H�E�H�E�H�E��9���H�5JDH�=��H���I��1�誥���H��H�������uV�E�A�EH�E�I�$E1�L�����H��蔣��H�}�苣��H�E�dH+%(��H��HL��[A\A]A^A_]�fD1�H�M�H�U�H��莡H��u�H�U�H�u�H�M�L���u������w���H�E�I��H�
��1�H�.��L�H1��&���H�}��
���HcE�L�}���~"H��M��N�,8fDL��I�� ����M9�u�L��A��������臦���H���UH��AUATSH��H��H��EH����H��Ћ{,���ujH�{ �C,����H��t
�Ţ��H�C H�{����S8H�C��uu�CP��uNH�{�5���H�{�,���H��H��[A\A]]����f.�諤��H�{ �C,����H��u��f�H�sH�==E���I��H��txA�,$듐L�cL��财�����w���M��H�
��1��SH�5��H�=-����N�������H�5<�H�=N���H��D����@L�-���H�=d�L���Ո��L��H�=T���T���ff.�����g����UH��AUI��ATA��SH�������Å�x"D���������uEH����[A\A]]��M��1�H�
��GH�5��H�=A���H����[A\A]]�M��H�
�1��]H�5ŵH�=����߻���������ff.�f�UH��AVAUATSH��H�$H��H�$H��dH�%(H�E�1�H��H�I��H�I��L����������uk�֬���8�}�{,1ɺ(L��������u�H�
��H�"���1��ݧ���C01�H�U�dH+%(u`H��([A\A]A^]�D��xHc�L��H���~���I�I�]�D�K���H�
t�H���1�D��1��l���������UH��AWE1�AVI��AUI��ATI��SH��H��H��tkH��A�},1�L��L)��t�����xH�I�I9�seO�$>���˫��D�A��t�1�H�
���1�H�7����H���[A\A]A^A_]�f�E1�H�
��1�1�H�[���豦��H��1�[A\A]A^A_]���UA��1�H�
����H��AVAUATI��H��SH��dH�%(H�E�1��[���M�����X訟��I�|$H�ËzA�C4�P�nA�9���I�|$H�C�+���H��`����
H��\���H�CA�$H��Dž\���n�1��H�1��f�OA�|$,�Ƨ��A�Ņ���M�D$1�A����1�H�
��H�|�觥��L�cD�k,H�=�@L���p���H�����L�c�CPH�=�@L���J���H��t�
+=9��L�KD�C4�e1�H�
Y�H�5��H�=S��~��{,膦��H�پH��PH��I���,���L��C(董��H�E�dH+%(�kH�e�[A\A]A^]�@蓩��H�
��H�H�1�D��1�贤��L������H�������f�H�55�L������2���H�����H�={�D�5@<�����1�H�=��H��I��1�����L��I���)���L�� 1�H�ٱ1��1���L���	���L��H��H������C4H��E���H�
��H�5�PL�C1�H�=����L���Û��H������XZ����@��&���L��I���ȩ��H�=�>L��H��薧���������H�54�H�=	���1����.���ff.�U1�H��AVAUA���ATSH���H�� dH�%(H�E�1�舠�����@H�{A�ĸf������������H�sH������lL��������nL��D��账������H�{H��@���������dH�{E�����轛�����H�{H�����H������N{H����H�{����������谟�����1���D�������d� D���_�������D�c,1��h����D�A������L�CH�
��1�1�H�H���������諦��H�
��H���1�D��1���ǡ��H�E�dH+%(��H�� H��[A\A]A^]Ð��覚�����&����I���L�C�1�D�H�
$�H�}�1��f����4@����L�C�1�D�H�
��H�6�1��8�����D��裛���W���fD�ӥ��L�C�1�D�H�
��H�ծ1����fD裥��H�
��H��1�D��1��Ġ���f�L�CH�
e�1�1�H����蛠���k���fD�K���H�
4�H�ٮ1�D��1��l����7��������L�C�1�D�H�
��H�i�1��8��������ޛ��ff.���UH��AWAVAUI��ATS��H��H��(dH�%(H�E�1��<���L��A��聝��H���H��L������蹢����L��H�������E�Mc�L���*���L��H�������K���L��A������A��M����H������1�RH��AUL�-þATL��P1��^���H�� ��u0A�D$�vLL���Ğ��E��L��I��H��1�1��&���H�E�dH+%(u_H�e؉�[A\A]A^A_]�fDE��L��H�z�1���1������fDL�������H�5:�L��轥�������c���U1�H��H�5=�H��AWAVAUATSH��H�7H�8��H��H���TI��H�
z�1�1�H�g�� �U���1�H�5�1�H��肗��1�H�5��H��I��1��l����L��I���<�������L���������L��蜘��I��H���L�=���H��1�L��L���ɥ��L���a���H��8H��H�����y���H��8H��H����L��L��1�A����L��軖��L���c���L���[���H���S���H��D��[A\A]A^A_]ÐL��H����1��J���E1��DL��H���1�1���(�����fDH�=i81�H���1�H�5���B���H�����f.�H�i��1�1��ۜ���f�H�q��1�轜��E1��"���DH�q��1�蝜����ff.���UH�e�� 1�1�H��SH���n���H��4H�;�?���H�{�6���H���.����)��H��4舚�#���.��H�=77H��t���H�"7H�=7H��t�!���H��6�q���<���H�]���ÐUH��AWAVAUA��ATI��SH��H��8dH�%(H�E�1��R���H����H�pH����H�{@����H��H�����8u=A�H��2H��H�E�dH+%(�H�e�D��[A\A]A^A_]�fDH�u�H���T�������H�}�賓��E��t~Hc�2L�e�L+e�I9�~�L�=��H��L�5�E��1�AWL�-
�I��L��L��1��՚��L��1�M��E��H��L���{XZE1��9���A��:���DHcQ2L�e�L�=��L+e�I9������y���@I��M��H�
[�1�H�Z���X���������UH��ATS�T���H�5N�H��H���"���H��t�@H������H�F�H��H������H��tL�`L���ޖ��L��H��H�P�o���H��[A\]��UH��AWE1�AVAUATSH��H��(dH�%(H�E�1��e���H��I���Z���H�u�L��H���۞��H�u�H��I���̞��H�U�I��H;U�uH��L��E1��A�����A��L���C���H���;���L���3���L���+���H�E�dH+%(uH��(D��[A\A]A^A_]��Ք��DUH��AVAUATSH��dH�%(H�E�1����H�u�I��H���.���L��H���Ð��H�u�H���G���H��I��謕��H��H�E�H��L�t8L������E�MI�N�fo�
I��H�xfo�
@E����L��E1��!@H��D�H9�HB�H��H�L�E��tHH��H��I9�D�IC�A��H��H)�H)�A��@u�H��D��G
H9�HB�H��E1�H�L�E��u�E��t)I9��
LB�L��H)�H��L9�IB�H��H��L)�H��H�5�褕��L��謏��H��褏��H�E�dH+%(uH��L��[A\A]A^]��P�����UH��AWA��AVI��AUM��ATI��H��0���SH��H��dH�%(H�E�1��������H�� ���H��$���L���pH��u{��L���D��$���D9��u��P����� ���9�����H����с�D9���M��tE�M��tA�E1�H�U�dH+%(��H�e�[A\A]A^A_]�D1��1�I��M��H�
�H�#�HDž(���蓖����L���H��(����qpH��u|H��(���L��識�����%D��L���M��1�1�H�
��H�y���?����`D��I�ؾ1�D�H�
_�1�H�n������� ����D��L����1�1�H�
)�H�Z��ݕ��H��(���豍��D��L�����P���D��$����� ������f�H��I��H�
�PH�b�1��1�茕��XZ�
���H��A��I��RH�
��H�_���DH��E��I��RH�
��H�o��D��L���H��I��M��H�
i��H���1�P1�����H��(������Y^�v���諐��ff.���UH�=L�H��ATS�)���H��H���$�H�������t&�H���ό������H��躌����un�H��詌����tA�H���W���H�e�D��[A\]���H���+���A�ą�xTI��H�
Z�1�1�H��� A��/����DI��H�
.�1�1�H�����	���E1��@軘��H��I��1��A��H�
��H����P1��ϓ��H���1�1�E��I�ؾH�
µ譓��XZ렺9H�5͢H�=��s���ff.����UA��H��H��SH���H��P���H��X���L��`���L��h�����t#)�p���)M�)U�)]�)e�)m�)u�)}�dH�%(H��8���1�H�EDž ���H��(���H��@���Dž$���0H��0���E��t[��*��t2H�� ����͑���H��H��H���1��O���H��臊��H��8���dH+%(u#H�]����H�� ����|����H�������ff.�f�UH��AWAVAUA��ATSH��H����������D�����L������dH�%(H�E�1�����H�����I�����H�5I*H�=̣H��H��1�譋��H��I��H�����軉��L����L����A�ƅ��@H�5�����2���H��H���M����H��H�=[��~�������eH��H�=���f�������ME����Ic�D����M��H�@I��H���I�}菒��H�����H�=(�H��1��v���H��H��I������L��A�����A�����A�uE1���K��H�pH�=�1��.���I��L��H�����L��A��襈��A�����I��E9}��I�UK�H�‹H�P��t�H��H�=-�1��֊��I��릐H��A��B�������
�E1�H������6���L���.���H�E�dH+%(��H�e�H��[A\A]A^A_]�f�H�
��1�1�H��A����E1�H����H�����跈����y(L�����H�
��1��SH�5��H�=0��lM���L��L���w������=���M��H�
b�1��SH�5h�H�=���k����fD�[���H�5�'L��H���H��I��H�=��1�����L��H������H���������I��H�
��1�1�H���������H�����HDž���D�����E��tyD�����H�5#'H�b�E���CH�=^�1��}���H��H��肇������	1�1�I�ؾ�H�
'�H���苎��H���c���E��u1�E1�����@H������T���H�5�&L��H���H��I��H�=��1����L��H������H������B�H���5��������H��� �������H�����H���)������E1�E1�E1�E1�萒��H��I�ًPL�����H���1��H��H�����H�h�H��H�����1�菍��_�1�1�AXH�
̰H����p���H��L��襓�����nM��tL��L��荓������	H������L������L���
���L������A��'���f.�H��H�=J����������H���I��I9������D����H��H�=�辈����������H���M�������H���]�����膎������H��薉�����pL�����L��,���H��(���L��H��L���+eH����L���J���H�5�$L��H���H��I��H�=��1���L��H������H��0���H���׋�����"��P�����L���H������7�������	H���ǃ�����f�E1�E1�E1�E1�H��1�誃��L��袃��L��蚃��L��蒃���K���D��H�5�H�=���k���H�=S�1��:�����H��I���:�A�ƅ��:���H�5G����у��H��H���
H��H�=��&�������H��H�=؝��������D�����E����Hc����L������L�����H��M��L�H�����I�<$M�l$�!���H���y���L��H�=/�H��1�����H��H��I��藆��L��A���|���A���t{E�\$E1�E��I�@H�pH�=v�1�辄��H��I��H���P���L��A���5���A���t4I��E9|$��L��H��ID$�8u�H��H�=�����A����L�����H�
=��1�1�H��A�����討��1�I�ؾD�H�
�H�%�1�M���É��I�� H��I��蓁��H������w��������L��E1��+���DI��H�
K�1��SH�5Q�H�=٬�e�8���H��H�=��1�����H��H��I��耏�����H�����H���i�������M���8���E1�E1�E1�L���ׁ�����/M���"���L��辁��������M��H�
��1��SH�5��H�=7��e���D�s���H�
<�H��1�D�(�1�I�� I��茈�����E1�H��藀������M���Y���H�5� H�=�1�H�ݔ�
����H��I���Z��������H��E1��B�������L��E1��*�������H�����H���3���������L��L��� �������M�����������f.��{���H�
D�H�!�1�D�(�1�I�� I��蔇�����H��H�=S��p�������\���H�����I�� I9������L�����H��H�=��=�������0���H���̄������H���܍������������H���������HH�������H�5BL���H�N�H��I��H�=G�1�蘀��L��H���~��H�������M������H�5�H�=B�1�H�-��Z����H��I���~����t#�L���~������H������1����L���v~�����RL��L��E1�E1��}������a�����H��M��M��P�_����ي��1��H�
���H���1����H�����H�� H��I���~�����G���@L�����H�
��1��SH�5��H�=%��b����H�����H��L���V^H��H���h��,�����(���H�����貂�����u����%���1��H�
G�D�H��1�A��@���H������~�����T����E1����I��H�
ۑ1��SH�5�H�=i��Da�E���誉��H��I��M���1�PH�����1�H��������H�
�1�1��I��H��袄��Y^�>���H��H�=�1��J~��H��H��I��輊�����Z����/���H��M��I�؋H�
L��1�H��E1�P1��C���AYAZ���L��H�=��1���}��L��H��I���[����������Έ��H��M��M��P�=���L��H�=G�1�E1��}��L��H��I������������M��H�
��1��SH�5��H�=!��_����b���H��M��M����1�PH�����1�H������y���H���1�1�M��H�
����Z���XZ��������H�
צH���1�D�(�1�I�� I���'����'�L������1�1�L�����H�
�I��E1�M��H������L���{�����}�����H�=��E1�E1�E1��wH�����H��1�H��1��/�I�ؾ1�H�
�H���1�萂���F���H�=4�E1�E1���vL��1�H��1����M��1�H�
��H���1��K�������E1�E1�E1��c�E1�E1�������H�
��H���1�D�(�1�I�� I��������跆��1��H�
��D�H�|�1�A��ҁ��H���y������耆��H�
I�H�:�1�D�(�1�I�� I��虁�����?}���J���1��H�
��H�Q�1��l���D����{��H�� H�����H��I���z����������h������1��H�
��D�(H��1�����D��I�� I���{����H���y����������i���ff.�f���UH��AWAVL�}�L�E�AUH�M�H�u�L��ATSH��XdH�%(H�E�1�H�E�L�E�H��H�M�H�u�H�E��
��H����H���'�L�E�H�M�L��H�u�H�}���~��H��H��thD�u�L�m�1�H��L�e����AVH�پAUI��H���1�M��1�� ���H�M�XZH��t��E�t�H�d��1�1������H�E�dH+%(uH�e�[A\A]A^A_]��}{��ff.�f���UH��AUATSH��H��H����H���{|��H����H�-----BEGH3H��H�IN CERTIH3SH	�t^�I�I�ľ����L�����H��H����1�1�1�H���?y��I��H����H���[���L���w��H��L��[A\A]]�DH�ERTIFICAH3CH�TE-----
H3SH	�u����I���|���f�H�=a��gH�5=��8^H���{��H���%���H��E1�[L��A\A]]�D���H�
ԝ1�1�H�I��E1��|~���L�������H�
��1�1�H�A���O~������f.�UH��AWAVM��AUL�m�ATSH��H��H��h���H��H�u�H�u��U�L��dH�%(H�E�1�H�E��E�H�E��VH��tRL�E�H�
�1�1�H�n���A��}��H�E�dH+%(�H�ĘL��[A\A]A^A_]�@H����H�����H��H�����Vu��H�}�L��H�U��f��I��H��u��E�L�e��E�L��p�������E1������L�m�M��E��M��A����E�A��I��A9���I�7H������t�E�OE����D��`���E1�I��I�wK�dI�UH��A�uH�x;0�g���L��M��L�m�L�C���tM�FH�?�L�M���1�H��`���H��1�H����l|��D�E�E���H�u�H�}�����D�E�E����H�M�Ic�E1�D��H���H��X���H��L�,H��x���I��L�m�M��D��L����H�E�I�� I9��I�7H������t�A�wE1����H��P���L���L��M�eA�uH��HCH�x;0�����qI��M��M�L�5���tM�FH��`�����1�1�H���A��f{���M����oLcu�H��p���K�vH��L�$�DH��H���ğ��I9�u�H��p����s���E����d���H�E�H��x���HcE�H��X�����~/L��X���H��x���I��H��I�fDH��H�� �ԟ��I9�u�H��x����r���
���fDA����DH�����H�U��(~��H�}�H�����H���~��H��H��H��x����|��H�߉E��Hr��H��x����<r���E����DI��E9g�k���L��D��`���E�������H������}��L��H�����I���}��L��H��H�E��C|��L��A����q��H�}���q��E����I��D9s����I��H��P���I�H�u��|���������A�GI����A�GHc��Ms��IcWI�GA�uH���t�IcGI�WI�}H��L�d����DžL���I�D$�S���Ic�M����H��p���H�R�L�,�A�EI�}��A�EHc���r��IcUI�EH�RL�l��A�A�EI�~�
��I�EI�~���I�E�}���tH���H��`����s���f�H�y�E1�HDžx���H��`���L��x����M�H��p����u�H�}��7�I��H��t/H��`����1�1�H�9��sx���U����
����4���H�=��lH��h���H�U��H��1���A�>H�
ӋtI�NH��`���H�5��1���X�L��M��L�m�A�6�U���A�uI��M���Q���H��p����o������D��L���D��H���M��E���
���A��H��x���� Ic�D�E��Uq��L��X���H��H��x���I��H�E�I��}��H�}�I�E�}��A�E�I�E�p��I�EA�I�~�I�]�[}��D�E�H�CD�E����D�}�H��p����E�gIc���p��H��H��H��p���H�E�Ic�H�@L�<��
}��A�G�I��Hp��I�GI��A�I�~D�e�A�E��|��I�~I�E��|��D�e�I�E����H�E�H��x���Ic�H��X��������Dr��@UH��AUE1�ATSH��dH�%(H�E�1����H��H��t^�s��H���Gt��I��H��toH��H���v��H�M�1ҾL���q��H�}�Hc��r��L��1ɺ�	I����p��L���6x��H����m��H�E�dH+%(u-H��L��[A\A]]ÐH�
���1�1�H�����u����mq��ff.�f�UH��AWAVAUATSH����V$H�^H�����H�����H��dH�%(H�E�1��U�H�VH�U��Er��1�1�A���H���w��H����H��I���x��H����H�==L����|����,������
�L��H����w��L�hM��u�@M�m0M����A�}u�I�uH����w����t�M�uH�ψM��u��M�v0M���lA�~u�I�vH���w����t�L����s��H��I���z��L��H�E�H���M�}M����L�-���M�0M����A�u�I�H�5F��,w����t�H�5J�L���u��H����H�pH����I�@��Uo��I��H�����8��H�5��H����v������H�*L���I�_H��u��H�[0H�����{u�H�sL���v����tݺH�5ۇH���������1�H�5̇H���x�����xH�5‡H����t��H���$H�pH���H�{@��}n��I��H�����8tR�y��L��H���lp��H���y��H��M��I��1�H����H�
ޓH��1�P1���r��ZYH����H�
L���L��L�-C��u��L�pM��u��M�v0M���
A�~u�I�vL���pu����tܺH�5†L���x������1�H�5��L���_�����mM�vM����L�-���M�v0M����A�~u�I�vL���u����t�H�
��1�1�H�����q���-H�
��1�1�H����q��M�0M���l���H�}��i��H��1�1���q���1�H�`��1��wq��1��Pi��L���w��H�E�H�=����e�1�H��1����H�E�HDž ���H�����H�����H�=l�D�`�o��H��H�=3�H��D��I��1��j��L��I����h��L�� 1�H�x~1���p��L���m��H�����L��H���V��I��H��usH�}��h��H�}��|h��L���th��1��mh��1��fh��H�� ���H��tH�{�Qh��H�{�Hh��H���@h��H�E�dH+%(�H�e�L��[A\A]A^A_]�H�����H�
����H�57{H�=z�L�@1��?M�\���H�C��1�1��o��H�V��1�1���o��H�E�H�}��g���Z���H�
���1�1�H�]��o��H�x��1�1��o���1�H�k��1��o��1��[g������H�
_���1�1�H����Zo��L���2r��L�-�H�5DH��L���	p��H� �H��x���H���QH�5;H��x���L����o��H��H���+H�5eL��H���o��I��H������n��H�E�H����H�}��#u��H�����ZI�]H���E1�E1��
H�[0H���|�{u�H�sH�=��|q����t�E�~L��Ic��h��J��I��Mc��E1�1�1�H�
b��H����9n��H��L����y���1�M��H�
4��H�@��n��H�lL������H���1�1���m��H�E��)���H��1����m��1��e��H�]��1�1��m������HDžp���H�J��1�1��m��HDž0���H��0����Me��H��p����Ae��H���1��1��Lm��1��%e��H�}��lt���y���H�
H��1�1�H����m���1���L��p���D��T���H�� ���E���_�����T�����{Hc��g��H��0���H�…���H��p���Hc�L��h���H��H��H��`���H��X���H�I��I���PH���w��L��I��H���L���`i��H�}��L��A����gr�����/I��L�+H��M9�tZI�>�k��I��H��u�H���1�1�L��h���L��`����l��L��X���H��0���I�I�?I����c��M9�u��|���L��h���H��p�����c���E����oH�}���p��I��H����L���n��H�5�sH��I���Hm��H��H���H�pH����I�~@���f��I��H����I�~@H���yc��H����H��L����g��I�}0H����e������H��x���L���d������E���A���3L���f��H�}��2r��L���Jq��������D��T���A����Mc�I��L���,d��H��E���H��0���I��I��I��fDI��I��M9��}
I�>���I�H��u�1�H�
��H�z��mj��1��h��A�D��T���E1�fDJ�<�I���3b��E9��H���b��M���m�E�H�E��E�H�E�D�-�E��tfH�\�H��0���E1�D��T���H��H���L�%�DJ�<��?�E��L�⾀H��H���I��I��1�1�I���i��L���a��E9��H�E�H���3�8�*H�}��o��I��H�E�H�U�L��H��H�����H�������BH���|L�%��M��1�1�L���H�3�*i��1�L��H�5:��IH�E�L�E�H�E�H�E�D�U�H��X���D�}�Dž`���HDž8���HDžh���E��~0Mc�I��H�]�M��L��O�$H��H�� 褍��I9�u�H�]�M��L���p`��E��~,H��X���Ic�H�RI��L�$�fDL��I����M9�u�H��X����3`����,�����~*H��h���Hc�,���I��L�$�@I�?I���`��M9�u�H��h�����_����`�����~*H��8���Hc�`���I��L�$�@I�?I����_��M9�u�H��8����_��H�}��_��L���_��H�
�1�1�I��H�����g����T�����~+H��0���Hc�T���I��L�$�@I�}I���S_��M9�u�H��0����B_��H����	H�=B��[H�]�1�H��1�H�����H�E�H�
�{H�=h�H��H��I��H�����LD�H��HEӋp1��Sa��I��H�� �������zH�PH�pH�=��1��)a��I��M��L�59sM��t#L��L��L��1��w`��L��I���^��L���^����jm��fo��L��L���@ly>H��I��1��5`��L��I���J^��L���B^�����H�u�H�}����H��H����D�U�E���xHc�T������kH��0���Mc�M��I��H��I��E����L��x���E1�L��D��X���H��h���L��`���L�E�H��x���N�$L��p���M��L�e��I�6H�;��������M��tI�vL����g�����@E�fE1�E����L�m�M��H�]���I��E9}�2L��H��IE���tNH�X��u�H�}�H�������h��H��H�����I���h��L��H��I���Xg��L������\��L����\����u�I�}H�]�M���k��I��H�E�I�� I9�����H��H9�h������D��X���M���B���L�-��1�1�L�%v�L��D�U��L���d��L��1�L��E1��]EH�E�L�E�H�E�H�E�D�}�H��X���D�U�Dž`���HDž8���HDžh����d����M��H�]�L�m��1���D��T����E�H�E��E�H�E�E������sH�5�yH�=�y�JC�8���H�U�H�u�L��蕶��H��H���H�E�D�.�D�}�H��X���E����	H��H��H���Hc�T������G
H��0���DžD���A�����HDžh���H��I��HDž8���H�����Dž`���Dž(�������L���D��@���D��@���H��X���1�E1�E���3��P���E��D��I��L�u�D��@�������I��D9���H�E�I�4$�M�H�8�����M���t�E�T$E���+1�A�����A�������x���D��p���L��E��I��E���m���uXH�^H�}�H�����H�M���e��H��H�����I����e��L��H��H���|d��L��E��Z��H���	Z���E�H�M���ED�I��D9a~ H�qK�dH�4Ƌ��u�E��I��D9a�I�̋�x���E��D��p���A��E����H��h�����D����Hc�D���D�M�D�u�H���Y[��H��h���H�\�H�E�H�8�g��D�M�D�U�H���x���E������D��(���I��DžP���D9������fD��P���L�u�E����jH�����I��I9�����D��D���L���D��@���E����H��h���H��0���H�3H�8�0c�������D���H�H�sH�߃�H�U�HcЉ�,���H���?Z��H�}�H�E�H�E����H�E�H���=
H�����H��8�����`����JH�
��H�J�H��H���H������H��h�����,�����IH��H�����,a��H�E�H���^
H�}�H�5����_c����Y��H��x���H���H�M�H�U�H�u�H��x����\�����9	���H�
�1�1�H�R�����_��H�54�H�}���[��H�5$�H�}���[��H�}��W��H��x����b��H�}��]��H���wH��H���1�1���H�m��`_����X��I��D���(����H��X���Ic�H�@H��Hc�(���H�U�L�$@H�BI��B� A�H�BJ�| �e��H�U�I�FH�BJ�| �e��L�m�L�E�E1�I�FD�U�L�� ���������`���Hc�`����H��8���H���_X��I�>H�\�H��8����d��H��X���D��(���DžP������A�����H�� ���H�=��H�p1��X��I���~���L��p����1�1�L��`���L�5�~�L�%b�L��L��L��x���L�M��^��1�L��L����>H�E�D�}�H�E�H�E�L�M�H��X���L��x���Dž`���HDž8���HDžh������H�=L��Q1���H��1����H���d���Z�1�H�
��1�H��E1��f]��H�E�L�E�H�E�H�E�D�U�H��X���D�}�Dž`���HDž8���HDžh����M��T���L�;L�k1���L�t�I�uI���^��H��M9�u�I��L����_��H�]�L��I��fDH��tSI���fDM�vM��t?M�.L���W��L��H���b����u�M��t H��L���]_��L��H���r_��I���DI��H�]�L���iW��I��M����M����M�vM��t/M�>L���,_��L��H���a����u�M��tL��L����^��I���L���`������1�H�
�|��1�H�A���[��L��E1��Z����T������s�H���S���E�H�E��E�H�E����H�E�L�E�H�E�H�E�D�U�H��X���D�}�Dž`���HDž8���HDžh�����H�
�{H�N��1�1��@[��H�E�L�%��H�}�L���UW��H�}�L���IW��H�}��S��H�}��GH��H���H�5׶�1���;L�E�D�U�H�E��	�H��8���H��0���H�3H�8�\������H���`���H�sH�ߋ�`���H�U�Hc�H���T����D�����,������1���^��A�����c���1�H�
{�1�H���OZ��1��xX����T��������H���R��H�5���1��:H��0�����Q����H�gz1�1�M��E��H��H�[���H��H�����Y��E���M���L��X���L�m�E1�I��I�>I���,�E��L�龀I��H��H��o1�1�A���Y��H���oQ��E9�u�L�m����I��L9��d����H�
Az��1�1�H����LY��H�}��s`��L���_���<�HDžh���Dž`���HDž8���H��H����1�1�L�%��H��L����X��H��L��1���9L�E�D�U�H�E�H�E����H�51��1�E1��9H��0���D��T���J�<�I���oP��E9���f���L�5yA��1�1�L��I��H��L�-���YX��L�e�I�<$�<[��1�1�H���P��L��L�꾀I��H��1�1��&X��H���Q��M�d$M��u�L�e�L��L���5V��D��T���E���������:H�5�mH�=Fs�H7��D���H�E���,�������L�-x�1�1�L�%��L��L���W��L��1�L��E1��c8H�E�L�E�H�E�H�E�D�}�H��X���Dž`���HDž8���Dž,���HDžh������RH�5�lH�=N��6����E1��R�1�1�H�
x��H�xk��V��H�Q�L�����1�H��k�1���V��1��N����H�}��5T�����L��x���H�u�L���
X��L���5R��A�ƅ��������E��1�H�
�vH��1���aV�����H�
�vH����1��BV���H�E����H��v1�1��L�5!�H��L��h���L��`���L���V��1�1�L��H�Zk���U��H��L���1��6������H�
vH���1�1���U���n���L�8E1����H�
k�1�1��U����T�����H��0���D��T���E1�J�<�I���;M��E9��H��0����*M��M�����L���P��H�}��`\���m�1�H�j�1��U����T������H��0�����L�������H�
,uH�5��"���L�5�u�1�1�L��H�~��T��1�L��A���H�5���5��T���������H��0����jL���D���DH�	��1�1��kT�����I�v@H��L��1��N�����H��i�1�1��;T�������O�����UH��AWAVAUATSH��H�U�L�ZdH�%(H�E�1�H�E�H�E�M���A����E1�1�H�Pj��L�]���S��L�]�1�1�H�Aj��A�K�S��L�]�� A�K���y��1�H�*jI��1��S��L�]�A�{
�A�CH�"rHc�H�>��@I�KL�]�H��j� 1�1��;S��L�]�H�E�D�E���?E�CA���!E�c1��
L�]�H��nH���[U��L�]�A9���	H�=�M�kH���X&L��L�]��W��H�U�H�u�L��I���{+L�]�H���!M��t6M��H�
/w1�1�H����L�]��R��H�=��L���7Q��L�]��XL�]���K��L��H����C4�P����XX��L��H�C�,���H�5��H�=+kH��I��1���K��L��I���I��L�cL����N��L�]�H��k�Y%�C,����L�]����L�]����$�H���c���L�]�H��I����#L�]�H����C8���L�]�H��I����"H�{�W��H�=��L�]�I��H���U(L��L�]��MV��L�]�H��t�H�5�]H�=Q��0L�]�L��L�]��LW��H�=e�H��H���U���
 �L�]����+'H�{@L�]��I��L�]�A�sL��H�=��1�L�]��>K��L�]�H��H��L�]��M��H�}�H��H���l���L�]�H��I���xL��L�]��H��H���H��L�]���H�]�H�U�H�u�L�]�H������D�[0E��L�]���L�]�H��t6H�}�荥��1�H�U�dH+%(��&H�e�[A\A]A^A_]�f�H�E�L�e�H�M�H�U�H�x L���4R��L�����G����L�]��^A���������@L�u�H�y]L�]�H��I�~��*E�L�]�E�������E�CA��
���D��H���F�����A���b����H�=��I�[1�H�5���L�]��T��H�=n�H���.T��L�]�H��I���H�x L��x����G��I�|$�4U��A�\$L��x���H�E���������!L�[��tXL��Z��tL��H�5�YH�=@jL��x����;.A�ؾ1�H�
�tH���1��N��L��x���L�eL��x���A�sH�U�H�
Nc1�1�H�=��L�=�Z�H��L��x���I�ſL��x����&U��fo~�L��L��H��I��fow�@
1���G��L��I���F��L���E��L����J��H�}�L��H��袦��L�e�L��x���H��I���{H�}�L��x����E��1��E��L���E��H��L��x���t0H�;L�]��E��H�{�E��H�{�E��H���zE��L�]�fDH�]�E�C� �K4D����r��1�H���QI��H�
�s1�AU�[M��H�{ Y^H��t
�E��H�C H�]�H�{��s��H�CM��������-���H�
iq�1�1�H���L�]��M��L�]�E�CL�%�s�1�1�L��H���L�]���L��L�]�H�����H�=hdA�[��J���H�=ތH����I��1��_F��L��A�H���nD��H�پ 1�H�Z1��vL��L�]�H��L�]��FI��L�}�H��H��L����H���,D��L�]�A�O4� E�CD���q��Q1�L��AUI��H�I�1��L��I� AXAYH�����DD��I�G I��r��I�G���fD�H�6E��H�]�1�1��H��H�=��H�@H�CH�E���F��L�]�H�C ���@��tgA��
�>H�kjJc�H�>��f�H�E�H�
%rH�N�1���D�@41��LK�����H�]�H�{��q��H�C����H�E�M�cL�]�D��x���L�hL��L���&L�]�����E�CD��x����[���I�KH��a1�1�� L�]���J��L�]�� 1�H��a1�A�K�J��L�]�1���H��a1�I�K �J��L�]�A�C(����L�]����\H��a�1�1��fJ��L�]�L�]�I�K8H��a����A�KH��`1�1���L�]��1J��L�]�H��`I�K����I�K1�1�H�qa��L�]�L�%m`H�?T��I��L�]�1�1�H�Ra� I�K��I��L�]�L��H�Ea� E�K E��HD�1�1��I��L�]�L��H�2aE�S$E��HD��G���I�KH�]`1�1�� L�]��sI��L�]�1���H�V`1�I�K�VI��L�]�A�C ����L�]�H�J`��tH�o�� 1�1��!I��L�]����L�]�I�KH��_���L�]�I�KH�<`���H�ߺ
1��AK��L�]��1�A��H�
�mH���1�E�C�H��L�]�H�����H�=ЩA�[�F��H�=Ȉ�	I��H����1��DB��L��H���Y@��H�پ 1�H�	V1�E1��^H��L�]��n���H�E�I�K M�C(L�]�A�SI�sH�x����L�]�H��H����E�kH�����H�=�_�F��H��H�=3�H��D��I��1��A��L��H����?��H�پ 1�H�xU1���G��L�]�H��L�]��D��H�}�H��H���Q���L�]�H�
�lH���H��I���rH��L�]��d?��L�]����A�sH�6\1�L�]�H�=���A��H��H���3D��H�}�H��H�����L�]�H��I����H��L�]��?��1��?��L�]����H�}�L��L�]��X��L�]�I���l���A�C L��x���E1䉅h���I�CH��p���DL���>��1�H�=�_1��N��A�ƃ����L�e�A�A�L��L�e�E��I���7D�A)�I9�IC�H�H��L)�H9�HB�I)�I�I�E����	Ic�L��L��D���mM��H��H����
H���u��J��D�A��t�L��x���D���D��x���L�]��@��D��x���H�
�kH��^�1�1���E��L�]�L��p���H�
$��_1�H�5�^H�=�kL�]���"1��=��L�]�H�����H�=�^A�[�C���H�=��H����I��1��A?��L��H���V=��H�پ 1�H�S1��^E��L�]�H��L�]��.B��H�}�H��H���ߝ��L�]�H�
DkH��H��I��������1�1��E��L�]��z���H�u�H�}�L�]�艘��L�]�H��H����A�s1�H�=4�L�]��#?��D�e�L�}�L�]�I��E����Ic�L��p���L��H��x���H��L�L��h���H�E�D��`���fDH�H�sH�=R�1�M���>��I��H��t'H��L��H�=�P1��>��L��I���)<��L���!<��D�{E1�E��W�	H�pH�=�\1��n>��I��M��t*L��L��H�=vP1���=��L��I����;��L��M����;��I��D9c��L��H��HC�������t��dH�5�NH�=_�#�I�{H�U�H�u�L�]��e���L�]�H��H���E�kH�����H�=�[�~A��H��H�=��H��D��I��1��=��L��H���);��H�پ 1�H��P1��1C��L�]�H��L�]��@��H�}�H��H��貛��L�]�H�
whH��I���k���H�������I�CM�{H�E�D��p���H�E�H�E�L��L��x���H�@�E�H��`���A�C H�E���P����ML��x���D��p������H�}�D��x���H���UL��p������L��p���H��H���6�?:��H�U�H�u�L���O���L��p���D��x���H��H��h����L�m��E���P���L��p�����x�����E1���D��L��X���M��H�]�D��H���D��x���A���A��I��E9��jI�4$H���ԧ����t�D��M��L��X���D��H���A��A�E����D��X���1�M��H��I�uH�[I�N(H��H�x�A9F ������D��X���M��H��A��Hc�D��H���H�RL��X���H��H�|�8��I�EH�|��8��A�mL��X���D��H����CA�EI�UD��H���L��X���D)�H�tH�<H�H�@H��H���D:��A�EL��X���D��H������3H�u�H�}�L��X���D��H�������L��X���H��I����D�m�H�E�D��H���E��H��X�������P����bL��X���E���L��P���D��M������I�� A9��I�4$H�}��3�����t�A�D$��~�1ɉ�E���I�D$I��M�n(I��L�H�x�A9F �����M��L��P���A��E��L��@���H��H���D��P���L�]��7��A�l$L�]�D��P���H��H���L��@�����A�T$I�D$H�qL�]�H��D��P���)�H�J�<Hc�H����8��A�|$L�]��TD�m�A�L�]�L��X���E��D��H��p�����x���L��訬��L�]�H����H�=t�L�]��;3H��`���L���H��1��R���L�]�A�{ H�
fRtI�K(H��cH�5���1�L�]��~L�]���x�����~4Hc�x���H��p���M��H�@I��H��@L��I����b��I9�u�M��H��p���L�]��,6���E�L�e�L�]���~)Hc�M��M��H��L�DL��I�� �c��I9�u�M��L��L�]���5��H��h���L�]��
A�[M������H�=ء1�L�]��%8��L�]�H��H��L�]��:��H�}�H��H���S���L�]�H�
�bH�ѢH��I�������o���H�=��M�k1�H�5q��L�]��C��H�=��L���DB��L�]�H��I��tQH�E�D�H�xE���UH�E�I�t$L�]�H�x�>L�]���tH�=7�L��L�]���;��L�]����mA�sH�=�1�L�]��A7��L�]�H��H��L�]��9��H�}�H��H���o���L�]�H��I���/���H�E�H�
$��5H�5�GH�=cL�@1���L�]���DD��L�e��6�������L����C��H��p���H�=NUI��H��1��6��L��H��I���4��H���DH�=E�H���A��H���D���L��x����0L�]��g5��H��p���H�I���B��I�|$ I�D$�v4����h���L�]���A�D$��
I�4$H�=��L��L�]��?��D�-��L�]�E���	1��|3��I�<$�A��L�]�H�=�H��I��1�A�s��5��L��H���L3��L�]��	���L��x���D��L�]��
@��L�]�D������H�=�S1��5��I������f.�H�=�S1�M���_5��I��H��t'H��L��H�=gG1��4��L��I����2��L���2��H�� H9]��J���L��p���1�H�=SL��h���D��`���L�]��4��L�]�H��I����L��L��H�=�F1�L�]��C4��L��H���X2��L���P2��E��L�]�~;Ic�H��x���L��x���M��M��I��M�f�L��I�� �4_��M9�u�M��L��L�]��2��L�]�H��L�]���6��H�}�H��H��衒��L�]�H��I���a�H�
�_���DL��x���L�]��>��H�
�_H��D���H��A9L$�������E���q����H�E�1�H�
S`H����L�@1��|9��H�}��c6����H�ߘ�1�1�L�]��U9��L�]���A�[H�����L�]�H�=�R�A7���H�=UyA�H����I��1���2��L��L�%�_H����0��H�پ 1�H��F1���8��L�]��k�L��x���L�]��=��H�
�^H��QD���H��A9]�+���M��A�����A�sH�=��1�L�]���2��L�]�H����A�s1�H�=��L�]��2��L�}�L�]�I�ċE�����`����bHc�L��x���M��H�RL��p���I��H��h���H�E�DI�uH�=DP1�L���S2��I��H��t'H��L��H�=[D1��1��L��H���/��L���/��A�EE1�M��X��H�PH�pH�=��1��1��I��M��t*H��L��H�=D1��N1��H��I���c/��L��L���X/��I��E9w~VI�WK�vH�‹��t#��t��H�5aBH�=�R���DH�pH�=]�1��v1��I���w���fDM��H�=bO1�I���T1��I��H��t'H��H��H�=\C1��0��H��I���.��L���.��I��L9m������H��h���1�H�=OL��p���H�U��0��H�U�L��x���H��I����L��L��H�=�B1�L�]��80��L��H���M.��L���E.����`���L�]���~+Hc�H�RM��M��M�$�fDL��I����Z��M9�u�M��L��L�]��.��L�]����H�
�[�1�1�H����5��L�]�H�����H�=ONE�k��3��H��H�=vH��D��I��1��/��L��H���-��H�پ 1�H�KC1��5��L�]��~�����H�5�NH�=�P��L�]�H�����H�=�NA�[�w3���H�=�uH����I��1��/��L��H���!-��H�پ 1�H��B1��)5��L�]��6���E�kH�����H�==N�3���
H�=-uH��D��H��1��.��H��I����,��L�� 1�H�rB1���4��L���1��H�}�L��H���S���L�]�H��I���11�L�]��x,��1��q,��L���i,��L�]�H�]�� E�C�K4D����Y��QH���1�jI��H�
�Z1��P4��H�{ XZH���o�|,��H�C H�{��Z��H�C�+�HDžh���A�[H�����H�=LL�]��2��H��h�����H�=tH��I��1��-��L��H���+��H�پ 1�H�`A1��3��L�]����I�K(H��J� 1��3��L�]��X�I�K0H��J� 1��x3��L�]��
�M��H�
�X1�L�]�H��?��N3��L�]�HDžh���A�[�'���H�����L��(���D��4���H��8�����@����6��L��H�����H���6��H��H��I���/5��H�߉�H����*��L���*����H�����@���H��8���D��4�����L��(��������I�D$M��A��E��L��P���J�|����=��1�H�5�f��L�]��4���r�����H�
RW�1�1�H�"��M2��L�]���H�
�V�1�1�H�U��(2��L�]��c�H�'I� 1�1��
2��L�]���A�[H�=��L�]��=&M��L��1�H�Ɖ�1��Y���L�]�H��1��M��H�
V1�E�CAUH���1��L�]�^_E�C��M���!��I�L�]��7��I�@I���*��L�]��k�1�H�E�H�
Տ�H�5o<H�=�WL��x���L�@1��pL�e�L��x����E�� �*��L�]�I�D$H��I�{(�!7��L�]�H�I�D$I�{0H�p�_��L�]��!���H��L�]���L�]��������H�]�H�{�eW��H�C���H�����D��8���H��H����.4��H��H���H�����I���4��L��H��H��@����2��L�牅H����H(��H��@����<(����H���D��8����������D��X���I�uM��H������� L�=�<�)��H��I�D$H�8�6��H�sH�I�|$H���^��L��x���H�U�1�L��;H�
�DA�sH�=��*��H�3H�=��I��1��*��M��L��x���H��I��t1H��L��L��1�L��x����R)��L��I���g'��L���_'��L��x���D�cH�SL��x���E���3H�sH�==�1��)��L��x���I��M��M��t1L��L��L��1�L��x�����(��L��I���&��L����&��L��x����L��x�����5��L��L��I��H�</samlInI�$L��1�A�D$fo>�(��L��I���&��L���&��L��x����J�L���L�L���M���M����L�!SM��1�L�]�L��H�
���0H�5;�H��蕃��L�]�A�[H�����H�=FL�]��V,��H�=onL��I��H����1���'��L��H����H��p���L�]�A���%���E�L�e�L�]������L��L�]���%��L�]�HDžh���A�[����A�H��L�]���1�1�H�
(RH�����-��M��L�]��9���L�#RM��1�L�]�L��H�
���,H�5:�H�=��L��� ,��L�]����L��x���A�sL�79�����x���������L��p���1�M��M��E�����I��9�x����NI�6H�}�������t�Hc�H��p���L��H���I��H�@D��X���H�<��cQ����x���D��H�ߋ�x����ƉE���b��D��X���L��H�������H�5�;H�=p|�L�]����H�=6D��H�59L�]���H�=��L�]��|��L��X���D��H���HDžh�����1�H�=�DL�]�L���s&��L�]�H��I���x����I��H�
4Q1�1�H��?�L�]���+��L�]��H�1�H�=6DL�]�L���&��L�]�H��I���-������H��p���E1�1�I����x���L��L�]��7���L�]�H��u�H�=�L�]���H��`���L���H��1������P���L�]����H�}PH�5��1�L�]��L�]���H��H�=S�1��l%��L��x���I������M��L��X���E��1�L�]�L��P������E����1�L��P���L��X���D��H������f.���I�� A9��uI�4$H�}��Ð����t�I�t$L����,����u�Hc�H��X����}�H��H��uO���U�A�u�H�߉u��a��D�m�L��P���A�L��X���E��D��L��H��p�����x���L�]��̗��L�]�H������H�=��L�]��_H��`���L���H��1��v���L�]�����=��1�H�5^���Y,��H�{@����V"��L�]����M����XH�5�1H�=�AD��H���L��X����D��H���L��X������'%����x�����x���L��]���M��H��p���D����~_��L��X���D��H�����L��P���D��H���D�m�����H�=�@�H�5�5�|H�=5�L�]����L��h������L��x�����A��L��D�m���M����P���H��X���D���__��L�]��~���H�5�0H�=�@L��@���H��H���D��P���L�]��L��@���H��H���D��P���L�]�����UH��AWAVAUATSH��H�$H��H�$H��L�������I��I��A��L��L�ɾdH�%(H�E�1�L���S ��H�����ߺƅ���.��H��E��M��PL��H�D��S1�1�AW��'��H�� H�E�dH+%(uH�e�[A\A]A^A_]��L#��ff.���������uH���H����f�U1�H�5vH�=��H���"��H���]�ff.���UH��AWAVAUATSH��H�$H��H�$H��x1�dH�%(H�E�1�L�����H�����H��p��L�����I��L�����H��x��H��h��L��x��L��L��L�� ��-��A�ƅ�uH�����H��ui�\+���8	u7����t/SH�/�1�E��j	M��H�
��1����j&��XZ�fD�H�U�dH+%(u0H�e�[A\A]A^A_]�D�PH��p��H��h����@�1����!�����UH��AWAVAUATSH��H�$H��H�$H��h1�H��p��L�����A��L�����dH�%(H�E�1�H�����L�����H��x��L��x��L��L��D�� �&��A�ƅ�uH�����H��uh�3*���8	u6����t.SH�6�1�E��j	E��H�
=�1����A%��XZ�D�H�U�dH+%(u*H�e�[A\A]A^A_]�DH�8�+��H��p��H�1���� ��D��UH��AUATI��SH��H��(dH�%(H�E�1��'���¸��uH�U�dH+%(uMH��([A\A]]�L�m�H�u�H��L���M���H��t1���@H�u�L��L���1���H��u�E�9E�������	 ��f���UH��AWAVAUATSH��H���!��I��1�I��wCE1�E1�L�5>�fD�<\u:E��u5L�xA�J�<;L����$��L�L9�r׸H��[A\A]A^A_]�H��1�[A\A]A^A_]�ff.�@��UH��AVI��AUA��ATI��SH��H���L��P���L��X�����t&)�`���)�p���)U�)]�)e�)m�)u�)}�dH�%(H��(���1��'��M��D��L��8H�EH��L�����H�����H��0���H�� ���Dž��� Dž���0���H��(���dH+%(uH���[A\A]A^]�������UH��AVAUATSH��H�$H���A��L��P���H��I��L��X���H�ʄ�t&)�`���)�p���)U�)]�)e�)m�)u�)}�dH�%(H��(���1�L�� �H�E�H���L��H��0���H���Dž� Dž�0H����`��H��1�E��ƅ���M��H��1�AVH������!��XZH��(���dH+%(u
H�e�[A\A]A^]��o��ff.�@��UH��AVAUATSH��H�$H���A��L��P���H��I��L��X���H�ʄ�t&)�`���)�p���)U�)]�)e�)m�)u�)}�dH�%(H��(���1�L�� �H�E�H���L��H��0���H���Dž� Dž�0H����@��H��1�E��ƅ���M��H��1�AVH�׉���� ��XZH��(���dH+%(u
H�e�[A\A]A^]��O��ff.�@��UH��I��A�ѾH���1�1�H���j ��L��;1�H�
2��6H�5I:���f���UH��SH��H��tH��H�?H��t��%��H��H�]��������ZH�5i0H�=:�h������UH�=c�H��t�rH�570H�=�9�6���fD����H�xH�+����1�]�f���UH��SH���=ܷ�t���H�]���D1Ҿ�(����Ã��t���������(��DH�
���1�1�H����w������"�����UH��H��AWAVAUATSH��xH��0���H��8���L��@���L��H�����t))�P���)�`���)�p���)]�)e�)m�)u�)}�dH�%(H�����1�H�EDž���H�����H�� ���H������I�Dž���0չt/H�����dH+%(��H�e�[A\A]A^A_]�f.�H������4���5��H���������H�R8H������H�558H��x���H��1����I��H���H�������C��������=$�1Ҿ����Å�����H�������HDž��f����HDž��HDž�������M!���������H������HDž�f���HDž����Dž������������!��H�
��H��71�D��1��	�������H�������1�1�H�������fDE1�H�
���1�1�H�6����L�����L�����H�
r�1�1�H�/��������H�������_������f.�M���L���?��H���I��H�~�E�x0H�����H������Mc�H�H�����L��H�����H�W�L������H������D��ȉ�������"��L������L��H������I�ĺA�@,L��ȉ���������I�|$H������I9κIC�H���v���I�|$H�����I9κH��H������IC�H���F���$I�|$$H������I9κIC�H��$� ���0I�|$0L��I9�L������IC�Ic�H��H��0���E����1�D��L����^��A9�tY����H������1�H�܄D��1��������^��HDž����H���������L���������f.�H������1ɺ�����I�ƃ�t{�N��H��E��1��A��H�y�PH������1��b��������ZY�v���E1�H�������1�1�H���4�������HDž�����J���DD�����1�1���H������H��4E��A�E������A��
�jE��I��L��L�������,��H������E����L������E1�L��p���������E��H��L��h���E��M���4�JA�L��M9�H�IC�H�<H��L)�H9�HB�I)�H�I�E9�slD�⋽����E1�L��D)�H���R����y����������1�H������D�H�h�1��L��p���L��h������������'���f.�������E��L��p���L��h������R��H������H�x����H������H��I�����L�����A�������H�5|3H��������t+H�5�3H�������tH���P��L���H������1�H�
��1�H�73�D��H�����L���������������H�
���1�1�H�ׂ�
���`�H������H��x���H�5(1����I����@���H�
\�H�21�D��1���������c��H�
,�H��11�D��1�����v����H������E��1�1�H�
2��Y��������HDž�����o���f�������1��1�H������H��1L��p���L��h������������1���H�71H��x���H���H���������H�������1�1�H�D�����������;��H������H�{���H��I�����L���x������>��ff.���UH��AWAVAUI��ATE1�SH���}�H���M�e1�H��H��[A\A]A^A_]��I�����I��H����HcE�M�<��&f.�H��L���������I��M9�tLI�>�,���H��H��u�H�
M��1�1�H�}p�����H�54�L�������^����L���P��9E��@����VH�5�(H�=������蓔��H���[
��H�
Ԉ1�1�H�i���O�����H�
���1�1�H���$����f���U�H��AUL�-b�ATSH��dH�%(H�E�1�H�E����1�L�� fo%�I��H�#�H��fo�@1�������1�H�M�H��H��I�������t5��[��H�XL� H�U�dH+%(uKH��[A\A]]�f.�H�E�I��L�龀H��1�L�H1��=��H�}��$��H�E������D��UH��AWAVAUATSH��8H������H�"�H������dH�%(H�E�1�H�����Dž���H����H�������I��H��t`�~����u1��1����AL���`��������������������a�����/������A�������
Dž��������E1�H������K�����������Icĺ�������1�������^����Ã��t����������i
��H����1҉��������A��A���S��L�������,�N������L��������o��u
�L���8t�1�������+�8��H�
��H��~1�D��1�D������R����������t������������t��������tkM��t L����
���������������������1��������H�U�dH+%(�NH�e�[A\A]A^A_]úH�5�,H�=�,�.�M��t�먺 H�5�,H�=�,���Z��H�
ӄH��}1�D��1�D������t��H������&���H����f�1�1�H��)���A��L��0���)��Mc�L��8�������H��1ҿ����H��1ҿ�����HDž0���L���%����1�L����E��_����BuҿL���������X���~-�1��@H��I9���A;�u�I9�������u�H������	H��� 
������L�����1�L���1���|
�����B��������w����H�= �q�����@1�H�q+���1�H��1�����A��t��1��]��D���u
��H�߾1�����Ã��t����3���߾�'�����@
��M�����������k����H������ H��*Hc�H��1��	��Lc�E����������1��������������L��H���R��L9����������������H������H�������������������L�%M�L������H�_}D�H��L��D�����1�1������������H���������H�����������/	�������e��D������1�D�H�
́H��z1�D������x���!������������A��H�
��1�A��H�{�1��E�����1��	������M���1�D�H��1�H�
[�H��yD���������������������u��1����H�����H�޿	H������c
���V������H�
�H��(1�D��1��
��1�����^��M���1�D�H��1�H�
ŀH�.yD������r
��������1��k���A��H�
��1�1�H�&z��D
�������H�5N(H�=�(��R�����A���H�
Q�1�1�RL������H��y���Y^���������H�����Dž�������H���������D�����H�
�D�H�:z�1�1���������B���M��L�%�M��H�|zD�H��L��D������x����"��L�%�M��H�!zD�H��L��D������M������L�%pM��H�VzD�H��L��D������"�������H�
EH�6yD��1�1������(������H�
H�=yD���D�����D�L���
���ff.���UH��AWAVAUATSH��H��dH�%(H�Eȋ���uMH��L�-��H�5�&H��������u�{(tA�H�5�H�=�&��f�1�H�57�H�=���[��L�-���f�H���)H������I��H��t�I)�L�pI����L��@���L��H��I��L���m��L��BƄ%@�������&�����H��H��H�8H����H�5��g��H����H�8H����L���J��H��H��trL���J��H�E�dH+%(u`H�ĘH��[A\A]A^A_]�fD�*H�5�H�=�%���1�H�5�H�=p��;���P���fDL������fD��UH��AWAVAUATSH��H�$H��hdH�%(H�E�1�I��L����H���L��I��I��I�EH����H�Dž������Dž�������H�H���	������L����I����1����%�M����=�tnH�=�[�j���L��H��1�H��1��u��I�ؾ1�H�
�{H��w1�����A�H�E�dH+%(��H�e�L��[A\A]A^A_]�fDH����L����L��H�ߺ��p��H���	1�H��1��U��A�ƅ��:H��0���������|H����H��`�H9��ED������H�A9���D������L�����A9���A9���D������P�����A9��fA9��]�o���u3�L��H������H���pH��L���	������H����H�BI��H��H��x����H��x�H��p�H��M��uH����H��x�H�H9�I��LB�N�L��H)�L9�IB�L)�H�H�I)���L��D��H����H�����C��H����H������y�����1�I�ؾD�H�
�yH�Iw1�����H��p�����f��������H���1��I��H�
nyH�I"PD����1����^_����=���H�=.Z����H��1�H��1���r��I�ؾ1�H�
yH�
u1��K���]���fD�
��I�ؾ1�D�H�
�xH�Pu1�����+���@I��H�
�x1�1�H��t���������@H������H��L����H�5g�&n��H���,���H�=6PH�������H��1�H��1��r��L��������H�=�PH��������L��H��1�H��1���q��L�����t����QI��H�
xH��tP�1�1��/��ZYA�D��L�������L�����)���@H��A��I��PH�
�wH�Gt�D�����	��H��I��H�
�w�H�� PD�����|���f�H��I��H�
bwPH�t�X���DQI��H�
EwH�NtP�;���H��p�E1�I�$H����I�E�3����	��H�
wH�?t1�D��1��6������I��M��H�
�v1�H�;t�1�����������D��UH��ATSH��dH�%(H�E�1�H�E�H��tmH��A��H�M�H��H�������u6H�U�H��t-L�JI��H�
Uv1�H�t�����H�}��y��D��H�U�dH+%(u'H��[A\]�fD��H�5:H�=E�����ff.���UH��ATSH��dH�%(H�E�1�H�E�H��tmH��A��H�M�H��H�������u6H�U�H��t-L�JI��H�
�u1�H��s������H�}����D��H�U�dH+%(u'H��[A\]�fD��H�5zH�=����;���ff.���UH��AUATSH��dH�%(H�E�1�H�E�H��tCI��I��H�M�H��L���~���H��H��t>H������H�E�dH+%(uiH��H��[A\A]]��H�5�H�=��h�H�E�H��t�L�HM��H�
qt1�H��r��1�����H�}����L������H����a������U�H�5�H��AWAVAUATL�%�	S��L��H��XdH�%(H�E�H���H�8�g�������u���tD�=љE��t(H�E�dH+%(��H�e�[A\A]A^A_]�fDH����L��H�5AH�8������t������fo\sL��H�5'I��foTsL��@H�V�H�8�>���H�
�sH��1�I����I��1����L���t����@����@$H�x0I������M����E1�1�1�H�����L������I�EH����L���#���H�̘L��
H�5�H�8�����
H�5���D�L��A�E H���H�8���H�H��I�EL��H�=�6��L�-p�f��H�_�L��L��H�5^H�8�:���L��H��I���l��������Z�|M��L�
�H��� ME�H�
?��HE�L�-1�H��p1��\���L���4���L�%ݗH�u�H�E�I�$H��H�E��A���M�L$D�E�1�H��H�
�qH��p1�� �	���D�M�E����H�E�H�]�I��L�m�H�E�D�}��LL�HM�$�1�H�
�qH�cp1����H�}����H�E��E�I���E�;E��I�$H�Q1�1�� �~���I�4$H�U�L��H�}�����I��H�E�H���z���D�E�1�E��~`M��I��f�K��I�4$L��H�}��L��H��H���mK��1�I��H��� 1�����H������I��D9m��M��L���g���7���f�L�m�f�L��)E��g���H�}��h���L��H�E������7������tO�M�H��1�1�� ����1���DH�]�1�H�
Sp� 1�H��`���H�������������D�(D������D�� 1�I��H�n1��(�������H�5�L��������u���y��Z���H�5�L�������t�M��H�
�o1�1�H��m��}�|�������H�E�H�������O��RH�
zo��pM�$H�On1�1��~���H�}��e���1�H�M�^_�l��������cH�5HH�=������H��H���UNKNOWNSESSIONCONNECTADDALIASREMOVEALIASQUERYALIASESQUERYMAPPEDALIASESCREATETICKETVALIDATETICKETREVOKETICKETVALIDATE_SAML_BEARER_TOKENINVALID<UNSET>../serviceImpl/alias.clistserviceclockSkewAdjustmentallowUnrelatedCertslistenTTLticketticketTTLXML Error: %s%s: Failed to open file "%s"
%s: Opening file "%s"
wfileLogger.cdata != NULL%s.%d%s: chmod() failed, %d
%s: about to stop main loop
VGAuthService%s END SERVICEsignalSource.cnbytes == sizeof infoinfo.si_signo < MAX_SIGNALSidx <= num<null>errorcriticalwarningmessagedebugunknownno time%FT%T%s.%03dZ[%s] [%8s] [%s] %s
Unable to open log file %s
Unable to reopen log file %s
FALSErequestNamesequenceNumberuserNameversionaddMappedLinkpemCertpidtokensamlTokenvalidateOnlyhostVerifiedaliasInfosubjectuserHandleInfoanySubjectcommentuserHandleTypesamlInfosamlSubject../serviceImpl/proto.cFound username in req type %dFound ticket in req type %dFound SUBJECT in req type %dFound comment in req type %dFound pemCert in req type %dFound pid in req type %dFound token in req type %dnamePasswordsspisamlsamlInfoOnlyuserAliasesaliaspemCertificatealiasInfosmappingsmappingsubjectsinfosuser-%s/%s%s%s%s: Illegal user name '%s'
mapping.xml%s/%s../serviceImpl/service.cstopListeningIOFuncg_unlink(%s) failed../serviceImpl/file.cpCountpCount > 0g_mkstemp(%s) failed../serviceImpl/filePosix.c%s: EOF on socket
%s: send() failed, errno %d
%s: condition: %d
parent%s: accept() failed, %d
rootReturning error message '%s'
gio.c%s: socket() failed, %d
%s: bind(%s) failed, %d
%s: stat(%s) failed, %d
%s: chmod(%s) failed, %d
%s: chown(%s) failed, %d
%s: fcntl() failed, %d
%s: listen() failed, %d
<NO CERT SUBJECT>%s: allowing error %d
samlSchemaDirschemas..catalog.xmlsaml-schema-assertion-2.0.xsdProcessing SIGHUP
is not yet validhas expired
-------END CERTIFICATE-----
../serviceImpl/netPosix.csocketDir != NULL%s.ANY-k%s bad pid %d read; skipping
-s-b%s: failed to daemonize
-hUsage: %s [OPTION]
	-s	Run in daemon mode.%s: unrecognized args
auditingauditSuccessEvents/etc/vmware-toolslocalizationmsgCatalogLANG%s: user locale=%s
/%s%smessages%s%s%s%s.vmsg../common/i18n.clocalPath != NULLUnable to open '%s': %s
bufmyValuevalueINIT SERVICE
build-24276846%s %s starting upallowSymlinksaliasStoreDirsuffix%s.badFailed to load schemas
xmlSecInit() failed %d
xmlSecCryptoInit() failed %d
listenConnectionMap == NULLmaxDataConnectionsPerUserdataConnectionMap == NULLBEGIN SERVICE
%s: main loop has exited%s/%sXXXXXX%s: fdopen() failed
(0 == num) || (NULL != aList)%s: fputs() failed
<userAliases>
</userAliases>
   </aliasInfos>
</alias>
%s: fflush() failed
%s: fsync() failed
%s: fclose() failed
%s: chown() failed, %d
<mappings>
</mappings>
    </subjects>
  </mapping>
      <anySubject/>
      <subject>%s</subject>
%s: trying to restore files
%s: failed to restore %s
%s.bakSSL error data: %s
../common/certverify.c-----BEGIN CERTIFICATE-----
<ANY>%s: no such user '%s'
%s: failed to save Aliases
Failed to parse document
No Subject node found
NameIDSubjectConfirmationMethod%s: method %s not bearer
SubjectConfirmationDataNotBeforeNotOnOrAfterRecipient%s: failed recipient check
Conditions%s: Time Conditions failed!
ConditionFailed to verify Conditions
Missing signature node
Missing KeyInfo node
Missing x509 node
Failed to create key managerFailed to init key manager
PEM cert: %s
Failed to register ID
Signature verify failed
Failed to verify Signature
../serviceImpl/verify.cnumCerts > 0%s: Token chain cert #%d:
%s%s: User '%s' doesn't exist
%s: User doesn't exist
%s: Store chain cert #%d:
%svalidateSamlToken failedTRUE<UNKNOWN>complete: %d
sequenceNumber: %d
requestType: %d(%s REQ)
version #: %d
userName: '%s'
userName: %s
addMapped: %d
pemCert: %s
Subject: %s
ANY Subject
*** UNKNOWN Subject type ***
comment: %s
userName '%s'
ticket '%s'
token '%s'
username '%s'
validate Only '%s'
hostVerified '%s'
Security check failedlistenConnectionMapsessionRequest failedaddAlias failedmaList[userIdIdx].num >= 0removeAlias failedqueryAliases failed<alias><pemCert>%s</pemCert></alias></reply>queryMappedIds failed<anySubject/><subject>%s</subject></subjects></mappedAliases>/dev/urandom%s: read error: %d
%s: Failed to close: %d
Ticket-%s-%s../serviceImpl/ticket.ccreateTicket failedvalidateTicket failedrevokeTicket failedUnrecognized requestSessionRequestConnectAddAliasRemoveAliasQueryAliasesQueryMappedAliasesCreateTicketValidateTicketRevokeTicketValidateSamlBToken<>/\../common/VGAuthUtil.ccatalogmsgState == NULLguest.log.text%s [vgauthservice] %s%s: socket() failed %d
%s: bind() failed %d
%s: connect() failed %d
%s: reply len: %u
%s: reply len too small (%u)
%s: unexpected EOF, failing
disabled%s: RPC unknown or disabled
Unknown commandservicePosix.cargspath%s: Couldn't fork, error %d.
/dev/nullpidPathFd >= 0%ld
@&!*@*@XMsgHasMsgID(msgid)len <= MSG_MAX_ID - 1%s: lstat(%s) failed (%d %d)
%s: fstat(%s) failed (%d %d)
../common/prefs.ckeyFile<default> resettingenableCoreDumpsCore dump limit set to %denableLogginglogfile%s: Using '%s' as logfile
data->path != NULLmaxOldLogFilesmaxLogSizenormalloglevelverbose%s: End of preferences
Group '%s'
	 %s=%s
������������ 	��0	��@	��P	��	��	������	���	���	��
��4
���	���	��T
���	���	���	��@��`��0�� �� ����������������������������������� ��� ��X ��X ��X ��X ��X ��X ��X ��� ��X ��X ��X ��X ��X ��X ��,!��X ��� ��m$��8$���#���#���#���#���#���#��H$��$��$���#���#���#���#���#���#���#���#��,$���#���#��X(��%��X%���'���'���'��'���$��@'��%��h'��p%���%���%��0&��P&��%���&��%��p&���&��(%���(���%���(���%���%���%���(���%���(���(���%���*���*���*��/*��\+��\*��֧������
���U�������,���
���@�������'���̧����������Ø��)���n��������������������CertVerifyX509ToStringCertStringToX509VerifyCallbackServiceInitTicketPrefsServiceInitListenConnectionPrefsServiceListenHashRemoveCheckCheckTimeAttrLoadPrefsLoadCatalogAndSchemaUserXmlFileOpenCertVerify_CertChainServiceVerifyAndCheckTrustCertChainForSubjectCertVerify_CheckForUnrelatedCertsBuildCertChainVerifySignatureVerifyConditionsCheckAudienceVerifySubjectSAML_VerifyBearerTokenAndChainServiceProtoValidateSamlBearerTokenProto_FreeRequestServiceNetworkListenServiceNetworkWriteDataServiceNetworkReadDataServiceNetworkCreateSocketDirServiceFileVerifyFileOwnerAndPermsServiceFilePosixMakeTempfileServiceAliasQueryAliasesServiceAliasAddAliasAliasDumpAliasesServiceFileSetOwnerServiceFileCopyOwnershipAliasDumpMappedAliasesFileAliasSafeRenameFilesServiceFileUnlinkFileAliasSaveAliasesAndMappedAliasLoadMappedAliasLoadAliasesServiceNetworkAcceptConnectionServiceReplyTooManyConnectionsServiceIOAcceptGSourceServiceIOAcceptProto_SecurityCheckRequestServiceCreateUserConnectionServiceStartUserConnectionServiceProtoHandleSessionRequestServiceProtoHandleConnectionServiceProtoAddAliasServiceAliasRemoveAliasServiceProtoRemoveAliasServiceProtoQueryAliasesServiceAliasQueryMappedAliasesServiceProtoQueryMappedAliasesServiceRandomBytesServiceCreateTicketInfoServiceProtoCreateTicketProtoValidationTypeStringServiceProtoValidateTicketServiceProtoRevokeTicketServiceProtoDispatchRequestServiceProtoReadAndProcessRequestServiceEndMainLoopServiceFileSetPermissionsServiceFileLoggerOpenServiceSuicideMsgLoadCatalogMsgGetUserLanguageI18n_BindTextDomainServiceIDVerifyStoreContentsServiceValidateAliasesServiceFileRenameFileServiceFileMakeDirTreeServiceAliasInitAliasStoreSAML_InitServiceInitDataConnectionPrefsServiceCreatePublicConnectionServiceIOMainLoopServiceStartAndRunmain%s: trying to free unknown request type %d
XMLSec Error: %s:%s(line %d) object %s subject %s reason: %d, msg: %s%s: Allowing %d of clock skew for SAML date validation
listenTTL set to invalid value of %d, using default of %d instead
%s: listen conn TTL set to %d seconds
%s: computed reapCheckTime as %d seconds
ticketTTL set to invalid value of %d, using default of %d instead
%s: ticket TTL set to %d seconds
%s: Incoming file name is "%s"
%s: failed to dup stderr to logfile
Processing SIGTERM; service exiting
%s: removing old listen conn for user %s
Signal source: reading from wake up fd failed.Too many signals queued, this shouldn't happen.
Could not queue signal %d (error %d: %s)
signum != SIGKILL && signum != SIGSTOPCannot set signal handler: %s
Unexpected element '%s' in parse state %dBad parse state, popping aliasInfo in req type %dBad parse state, popping pemCert in req type %dBad parse state, popping (any)subject state %dBad parse state, popping unknown parse state %dTrying to handle new request of type %s when processing a request of type %dFound version number in req type %dFound addMappedLink in req type %dFound ANYSUBJECT in req type %dFound SAML token in req type %dFound validateOnly option in req type %dFound hostVerified option in req type %dFound userHandle type in req type %dFound unrecognized userHandle type %sFound samlSubject in req type %dUnexpected contents '%s' in parse state %d%s: Unable to parse contents of '%s': %s
%s: failed to load Aliases for '%s'
Failed to change ownership of %s%s: error %d reading from socket
%s: asked to send %d bytes; bad caller?
%s: got new connection on '%s', sock %d
The user exceeded its max number of connections<?xml version="1.0" encoding="UTF-8" ?><reply><sequenceNumber>%d</sequenceNumber><errorCode>%Lu</errorCode><errorMsg>%s</errorMsg></reply>User %s exceeding concurrent connection limit of %d connections (connection ID is %d)Established a new pipe connection %d on %s%s: unlink(%s) failed, %d - continuing
%s: failed to get uid/gid for user '%s'
%s: name: %s ok: %d error '%s' (%d) at %d depth lookup:%s
%s: error '%s' (%d) treated as failure
%s: Using '%s' for SAML schemas
Error: catalog file not found at "%s"
Error: Failed to load catalog at "%s"
Failed to create schema parser context
Error: Failed to parse schemas
Failed to create schema validation context
%s: Could not parse %s value (%s).
%s: FAILED SAML assertion (timeStamp %s, delta %d) %s.
%s: g_lstat() failed on '%s', %d
%s: Unable to look up userinfo of '%s' to check ownership of '%s'
%s: Unable to look up userinfo of '%s' to check ownership of '%s', but found valid entry for uid %d
%s: username '%s' lookup failed, but found uid %d -- temp NIS outage?
%s: failed to look up uid %d; assuming user is deleted or NIS is inaccessible
%s: uid mismatch for %s (want %d, found %d)
%s: gid mismatch for %s (want %d, found %d)
%s: file permission mismatch for %s (want 0%o, found 0%o)
/var/run/vmware/guestServicePipe%s: socket dir path '%s' already exists as a non-directory; canceling
%s: Created socket directory '%s'
%s: g_mkdir_with_parents(%s, 0%o) failed (%d)
%s: failed to create socket dir '%s' error: %d
/var/run/vmware/vgauthsvclog_pid.txt%s: failed to open pid file '%s', error %u
%s: sending SIGTERM to service at pid %d
%s: pid %d not found, returning success
%s: kill(%d) failed, error %u
Service to support SAML token and ticketing authentication for VMware products.
	-k	Shut down the running instance that was started as a daemon.	-b	Run in background mode, using a pid lock file.	-h	Display this help and exit.%s: Using LANG override of '%s'
%s: loading message catalog '%s'
Unable to read a line from '%s': %s
Couldn't parse line from catalog: %sInvalid UTF-8 string in message catalog (key = %s)
Cannot load message catalog for domain '%s', language '%s', catalog dir '%s'.
/var/lib/vmware/VGAuth/aliasStoreUsing '%s' for alias store root directory
@&!*@*@(alias.dir.badperm)Alias store directory '%s' has incorrect owner or permissions.  Any Aliases currently stored in '%s' will not be available for authentication%s: failed to open alias store %s: %s
@&!*@*@(alias.mapfile.badperm)Alias store mapping file '%s' has incorrect owner or permissions.  The Aliases in the mapping file will not be available for authentication@&!*@*@(alias.alias.badperm)Alias store '%s' has incorrect owner or permissions.  The Aliases for user '%s' will not be available for authentication%s: g_rename(%s, %s) failed (%d)
@&!*@*@(alias.alias.renamefail)Failed to rename suspect Alias store '%s' to '%s'@&!*@*@(alias.alias.rename)Suspect Alias store '%s' renamed to '%s'%s: alias store had invalid contents
@&!*@*@(alias.dir.notadir)Alias store directory '%s' exists but is not a directory%s: Failed to load alias for user '%s'
%s: orphaned mapped alias: user %s subj %s cert %s
@&!*@*@(alias.dir.renamefail)Failed to rename suspect Alias store directory '%s' to '%s'%s: failed to set up Alias store directory tree
%s: failed to init alias store; exiting
Error: xmlsec1 lib version mismatch
xmlSecCryptoAppInit() failed %d
%s: Using xmlsec1 %d.%d.%d for XML signature support
%s: failed to init verification; exiting
Failed to initialize the listen connection mapmaxDataConnectionsPerUser set to invalid value of %d, using default of %d instead
Maximum number of data connections per user set to %dFailed to initialize the data connection mapstrlen(conn->pipeName) < UNIX_PATH_MAX%s: failed to setup public listen channel
%s: failed to create public listen sock; exiting
%s: failed to listen on public sock; exiting
%s: removed empty alias file '%s'
<?xml version="1.0" encoding="UTF-8" ?>
<alias>
   <pemCertificate>%s</pemCertificate>
   <aliasInfos>
      <aliasInfo>
         <subject>%s</subject>
         <comment>%s</comment>
      </aliasInfo>
      <aliasInfo>
         <anySubject/>
         <comment>%s</comment>
      </aliasInfo>
%s: Unable to look up userinfo to change ownership of '%s' to '%s'
%s: removed empty map file '%s'
  <mapping>
    <pemCertificate>%s</pemCertificate>
    <userName>%s</userName>
    <subjects>
@&!*@*@(alias.alias.badfile)Alias store '%s' exists but is not a regular file.  The Aliases for user '%s' will not be available for authentication%s: alias store file %s exists but isn't a regular file, punting
@&!*@*@(alias.mapping.badfile)Mapping file '%s' exists but is not a regular file.  The Aliases in the mapping file will not be available for authentication%s: map file %s exists but isn't a regular file, punting
SSL error: %lu (%s) in %s func %s line %d
%s: unable to convert string to BIO
%s: unable to convert string to x509
%s: client tried to add a duplicate subject '%s' for user '%s'
%s: client tried to add a duplicate mapping entry for subject '%s' and cert '%s'
@&!*@*@(alias.addid)Alias added to Alias store owned by '%s' by user '%s'%s: alias added with Subject '%s'%s: out of memory creating BIO
Failed to validate doc against schema
Failed to validate token against schema
%s: NameID not found in Subject
%s: Missing SubjectConfirmation method
urn:oasis:names:tc:SAML:2.0:cm:bearer%s: subjConfirmData time check failed
%s: audience check: token: '%s', host: '%s' ? %d
Failed to verify Subject node
%s: No Conditions found, accepting
Missing x509 certificate node(s)
Missing x509 certificate base64 data
%s: Failed to add cert to key manager
Failed to add cert to key manager
%s: token is hostVerified, skipping signature checkFailed to limit allowed key data
%s: Signature is invalid (got %d)
%s: signature is invalid (got %d)
%s: failed to convert cert to X509
%s: unrelated cert subject: %s
%s: Success!  no unrelated certs found
Unrelated certs found in SAML token, failing
%s: failed to load mapped aliases
%s: no matching cert and subject found in mapping file
%s: no mapping entries or specified userName
%s: found more than one user in map file chain
%s: %d certs in store for user %s
%s: No trusted certs in chain
%s: failed to convert PEM cert to X509
%s: failed to convert untrusted chain
%s: failed to convert trusted chain
%s: unable to create x509 store
%s: unable to create x509 store context
%s: unable to init x509 store context
%s: unable to verify x509 certificate (ret = %d)
%s: cert chain validation failed
%s: cert chain successfully validatedmatchIdIdx >= 0 && matchSiIdx >= 0%s: ServiceVerifyAndCheckTrustCertChainForSubject() returned %Lu
@&!*@*@(validate.samlBearer.fail)Validation of SAML bearer token failed: %d@&!*@*@(validate.samlBearer.success)Validated SAML bearer token for user '%s'<?xml version="1.0" encoding="UTF-8" ?><reply><sequenceNumber>%d</sequenceNumber><userName>%s</userName><token>%s</token><samlInfo><samlSubject>%s</samlSubject><aliasInfo><subject>%s</subject><comment>%s</comment></aliasInfo><aliasInfo><anySubject/><comment>%s</comment></aliasInfo>ServiceNetWorkWriteData() failed, pipe = %s%s: %d unrelated certs found in list
%s: Unrecognized condition found!
%s: read EOF on Connection %d
%s: g_markup_parse_context_parse() failed: %s
No Subject type specified (assuming removeAll case)
Unknown request type -- no request specific data
@&!*@*@(proto.attack)Possible security attack!  Request type %d has a userName (%s) which doesn't match the pipe owner (%s)!%s: Possible security attack!  Request type %d has a userName (%s) which doesn't match the pipe owner (%s)!
%s: Unrecognized request type '%d'
%s: security check failed for request type %d
%s: version mismatch.  Client is %d, want %d
sessionRequest failed; version mismatch%s: Already have a connection for user '%s', but the user check failed, so tearing down the connection and trying to rebuild
%s: failed to setup private listen channel
g_hash_table_lookup(listenConnectionMap, userName) == NULL%s: removing dead userConn for %s from hashtable%s: removing failed userConn for %s<?xml version="1.0" encoding="UTF-8" ?><reply><sequenceNumber>%d</sequenceNumber><version>1</version><pipeName>%s</pipeName></reply>%s: failed to send SessionReq reply
<?xml version="1.0" encoding="UTF-8" ?><reply><sequenceNumber>%d</sequenceNumber><challengeEvent>%s</challengeEvent></reply>%s: failed to send Connect reply
<?xml version="1.0" encoding="UTF-8" ?><reply><sequenceNumber>%d</sequenceNumber></reply>%s: failed to send AddSubject reply
@&!*@*@(alias.removeid)Alias removed from Alias store owned by '%s' by user '%s'%s: all aliases removed for requested username%s: alias removed with Subject '%s'%s: failed to send RemoveAlias reply
<?xml version="1.0" encoding="UTF-8" ?><reply><sequenceNumber>%d</sequenceNumber>%s: failed to send QueryAliases reply
<mappedAliases><userName>%s</userName><pemCert>%s</pemCert><subjects>%s: Failed to open random device: %d
TicketGenerateTicket() failed, user = %s<?xml version="1.0" encoding="UTF-8" ?><reply><sequenceNumber>%d</sequenceNumber><ticket>%s</ticket></reply>%s: failed to send CreateTicket reply
<?xml version="1.0" encoding="UTF-8" ?><reply><sequenceNumber>%d</sequenceNumber><userName>%s</userName><token>%s</token><userHandleInfo><userHandleType>%s</userHandleType><samlInfo><samlSubject>%s</samlSubject>%s: Tried to convert a validationType of %d to a string
%s: processed reqType %d(%s REQ), returning %Lu on connection %d
[function %s, file %s, line %d], %s, [errno = %d], %s
%s: getpwnam_r(%s) failed %d (%d), try #%d
%s: getpwuid_r(%d) failed %d (%d), try #%d
[function %s, file %s, line %d], %s
Assertion '%s' failed at %s:%d
%s: Failed to set up VMX logging
%s: couldn't get VMCI address family
%s: failed to create VMCI socket
%s: failed to build RPC packet
%s: failed to send packet (%d)
%s: failed to read reply length (wanted %d, got %d) (%d)
%s: failed to read reply  packet (%d)
%s: failed to send RPC packet
%s: Error sending RPC, assume they aren't supported
%s: new RPC Failed, using old
%s: failed to create X509 stack
%s: failed to add cert to stack
sk_X509_num(chain) == numCerts%s: Using '%s' as preferences filepath
%s: g_key_file_load_from_file(%s) failed: %s
%s: Couldn't open PID path [%s], error %u.
%s: Lock held on PID path [%s], error %u, not daemonizing.
%s: Couldn't create pipe, error %u.
%s: Couldn't set close-on-exec for fd %d, error %u.
%s: Couldn't fork first child, error %u.
%s: Child %d exited with error %d.
%s: Child %d exited with signal %d.
%s: Child could not exec %s, read %d, error %u.
%s: Couldn't create new session, error %d.
%s: Couldn't chdir to /, error %u.
%s: Couldn't write to parent pipe: %u, original error: %u.
%s: Couldn't truncate path [%s], error %d.
%s: Couldn't write PID to path [%s], error %d.
%s: Couldn't flush PID to path [%s], error %d.
%s: Couldn't exec %s, error %d.
%s: size of %s too large %d; failing read
%s: mapping file %s exists but isn't a regular file, punting
%s: file %s exists but isn't a regular file, punting
%s: failed to open %s for read (%d)
%s: size of %s changed (%d vs %d)
%s: mode of %s changed (%d vs %d)
%s: uid of %s changed (%d vs %d vs %d)
%s: gid of %s changed (%d vs %d vs %d)
%s: realpath() failed. errno (%d)
%s: Real path (%s) is not same as file path (%s)
%s: failed to read from file %s (%d)
%s: Pref_GetBool(%s) failed: %s
%s: Pref_GetInt(%s) failed: %s
%s: Pref_GetString(%s) failed: %s
Failed to set core dump size limit, error %d (%s)
%s: Unrecognized loglevel '%s'
VGAuthService%s '%s' logging at level '%s'
%s: %d preference groups in file '%s'
%s: g_key_file_get_keys(%s) failed: %s
%s: g_key_file_get_value(%s:%s) failed: %s
-----BEGIN CERTIERTIFICATE-----
</samlInfo></rep</userHandleInfoleInfo></reply>/etc/vmware-toolols/vgauth.conf/var/log/vmware-e-vgauthsvc.logPref_GetStringPref_GetIntPref_GetBoolServiceLoadFileContentsPosixPref_LogAllEntriesServiceFileLogger_InitService_InitLoggingServiceDaemonizePref_InitPEMChainToStackVMXRPC_InitCreateVMCISocketVMXRPC_SendRpcSendLogStringVMXLog_LogVUtil_AssertUsercheckLookupUidUsercheckLookupUser��������;_xs��8����`����x����ȓ���
���� ��������8����H���������(�������,X���Px����(����x������������T8����������������������(h���X����|�����ؽ���Ⱦ���X�������(����H8���h���X�������h��4���\(���(���h���(��(	���h	����	x���	���
���@
H��x
���
x��
��8�0X�\��H������(�H��lh�������
���L
8���t
X����
�
���
���(x
��X(�������7���Xc��(d��Dxd��d�e����f���hg���h���h��Dj��p(k���xk����k���l����l�� 8u��L�v��|�w�������؁������4x���\8��������zRx�Ы��&D$48p��FJw�?9*3$"\ ���0t8����P���
�L���3�x���$�t���iA�C
B�J��T �����oA�C
B�D�`���� (ĭ��YE�C
C��I<L���J�C
A�{
��GZ
��F���A��,����E�Q
B�E�E�E�D�~ �`���BE�C
C��v$�����4E�C
A�U
BSD�����E�C
A�z
EK
EK
EK
EX
HK
E<P,����E�C
A�r
EK
EK
EX
HK
E �����zA�O
A�h ������A�V
E�m
W �ı���A�V
E�m
W$�����E�C
J���
A,$x����E�T
B�N��F�[
Fi T���1A�C
B�D�fx$���(� ���A�C
I������
B�����E�S
E�$����E�C
B�L�~
D$�P���\E�C
B�L�@
A$����9E�S
RD����9E�S
R$dȸ���E�C
B�H�S
K(�P���jA�C
B�E�D�{
F(�����jA�C
B�E�D�s
N(�غ���E�E
I�����e
H����������$0,���E�C
J��S
K(X$����A�C
D��H��
AL������E�C
B�E�H�p
Id
Dd
Dd
Dh
Hd
D�H��@��V
R�,�h���E�I
F���F��s
K<$����E�C
B�E�D�s
Jg
Ic
Eg
ADdx���E�C
B�E�D��
H�
Dy
Gc
EP
H,�����E�C
B�E�E�D�w
I,����FE�C
B�E�E�D�o
I,����A�E
D��L�E�H��
E4<@���A�C
B�E�D�@
Al
Dp,t����A�E
J���E�H��
G@�8���J�C
E���z
�B�B�A�O�����H��������	,�����A�C
B�E�H�e
Hp
A(,�� A�C
f�����
F0X����A�C
B�E�E�E�D�t
Co(����"E�T
F���R��
E(����BA�E
D��K���
B,����mE�C
F���F��
G,	��A�S
M�����-
B D	���E�S
E��,h	d��A�C
F���E�D��
G �	��iA�C
C��a,�	��A�C
B�J�����
A(�	���A�C
K����k
A,
���E�C
B�E�E�E�K��
F$H
t�dE�J
C��r
D p
��E�I
H��
H,�
(���(E�C
F���F��t
A,�
��sA�C
F���M��
J,�
���E�C
D��\����
A,$���vE�C
E����
Fj
F,T����A�C
D��E�G���
E(�����A�C
B�J���
B,�L��!A�C
P�����`
A0��(���+E�C
P������
J(8T���A�C
e������
A@�T��Ba�S
M(`U��)E�C
e������
F(�V��E�C
e������
F$�W���E�C
D��D�
A,�|W���E�C
I�����k
DP,
�W���E�C
B�E�E�D��
A(@
�X��E�C
Z�����
A(l
�Y��E�C
Z�����
A�
�Z��GE�\
 �
�Z��HE�C
E�]
F�
�Z��NE�K
} �
[���E�C
E�U
F(p[���E�F
P������
K,H�c��^E�C
F���E�H�e
H(xe���E�H
B�N���
K,��e��bE�C
P�����1
A,�(n���E�C
I�����h
G(�o���E�C
\������
G$0|u���E�C
G���
G$Xv���E�C
G���
G$��v���E�C
I���]
B,�Tw��eE�O
H����H�e
G��@�΁݁������'�	6�
C���0� �а`�@��(5APP
l�������o���
�8�86�1P	���o���o�0���o�o�.���o��0P@PPP`PpP�P�P�P�P�P�P�P�PQQ Q0Q@QPQ`QpQ�Q�Q�Q�Q�Q�Q�Q�QRR R0R@RPR`RpR�R�R�R�R�R�R�R�RSS S0S@SPS`SpS�S�S�S�S�S�S�S�STT T0T@TPT`TpT�T�T�T�T�T�T�T�TUU U0U@UPU`UpU�U�U�U�U�U�U�U�UVV V0V@VPV`VpV�V�V�V�V�V�V�V�VWW W0W@WPW`WpW�W�W�W�W�W�W�W�WXX X0X@XPX`XpX�X�X�X�X�X�X�X�XYY Y0Y@YPY`YpY�Y�Y�Y�Y�Y�Y�Y�YZZ Z0Z@ZPZ`ZpZ�Z�Z�Z�Z�Z�Z�Z�Z[[ [0[@[P[`[p[�[�[�[�[�[�[�[�[\\ \0\@\P\`\p\�\�\�\�\�\�\�\�\]] ]0]@]P]`]p]�]�]�]�]�]�]�]�]^^ ^0^@^P^`^p^�^�^�^�^�^�^�^�^__ _0_@_P_`_p_�_�_�_�_�_�_�_�_`` `�Q,|������ХЩ�������/usr/lib/debug/.dwz/x86_64-linux-gnu/open-vm-tools.debuge�S��QH���1�s,��6a5791783e815ddf83d463493ba36d2480e80e.debugv�Xg.shstrtab.interp.note.gnu.property.note.gnu.build-id.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.got.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.data.bss.gnu_debugaltlink.gnu_debuglink880&hh$9�� G���o��0Q���Y���a���o�.�.(n���o�0�0}�1�1P�B8686�PP� P P�0`0`0�````�`p`p���ll
�pp�l �������������������������� �����P�8�8��� 	��( �M 48/

Filemanager

Name Type Size Permission Actions
X11 Folder 0755
411toppm File 14.3 KB 0755
JxrDecApp File 26.38 KB 0755
JxrEncApp File 27.77 KB 0755
NF File 963 B 0755
VGAuthService File 130.54 KB 0755
[ File 54.44 KB 0755
aa-enabled File 18.3 KB 0755
aa-exec File 18.3 KB 0755
aa-features-abi File 18.3 KB 0755
ab File 58.43 KB 0755
acpidbg File 1.58 KB 0755
add-apt-repository File 16.04 KB 0755
addpart File 14.38 KB 0755
animate File 14.31 KB 0755
animate-im6 File 14.31 KB 0755
animate-im6.q16 File 14.31 KB 0755
anytopnm File 12.26 KB 0755
apport-bug File 2.27 KB 0755
apport-cli File 13.31 KB 0755
apport-collect File 2.27 KB 0755
apport-unpack File 3.7 KB 0755
appstreamcli File 138.23 KB 0755
apropos File 47.28 KB 0755
apt File 18.38 KB 0755
apt-add-repository File 16.04 KB 0755
apt-cache File 86.47 KB 0755
apt-cdrom File 26.47 KB 0755
apt-config File 30.39 KB 0755
apt-extracttemplates File 22.47 KB 0755
apt-ftparchive File 222.48 KB 0755
apt-get File 50.47 KB 0755
apt-key File 27.99 KB 0755
apt-mark File 54.47 KB 0755
apt-sortpkgs File 50.4 KB 0755
arch File 34.51 KB 0755
aria_chk File 5.52 MB 0755
aria_dump_log File 5.31 MB 0755
aria_ftdump File 5.32 MB 0755
aria_pack File 5.35 MB 0755
aria_read_log File 5.48 MB 0755
arpaname File 14.3 KB 0755
asciitopgm File 14.3 KB 0755
atktopbm File 14.3 KB 0755
automat-visualize3 File 984 B 0755
avstopam File 14.3 KB 0755
awk File 722.5 KB 0755
b2sum File 54.51 KB 0755
base32 File 38.51 KB 0755
base64 File 38.51 KB 0755
basename File 34.51 KB 0755
basenc File 46.51 KB 0755
bash File 1.38 MB 0755
bashbug File 6.82 KB 0755
bc File 90.82 KB 0755
bdftopcf File 42.26 KB 0755
bdftruncate File 14.15 KB 0755
bioradtopgm File 14.3 KB 0755
bmptopnm File 26.3 KB 0755
bmptoppm File 26.3 KB 0755
boltctl File 122.84 KB 0755
bpftrace File 2.15 MB 0755
bpftrace-aotrt File 985.37 KB 0755
brushtopbm File 14.3 KB 0755
btrfs File 1001.25 KB 0755
btrfs-convert File 576.3 KB 0755
btrfs-find-root File 520.3 KB 0755
btrfs-image File 552.3 KB 0755
btrfs-map-logical File 520.3 KB 0755
btrfs-select-super File 516.3 KB 0755
btrfsck File 1001.25 KB 0755
btrfstune File 544.3 KB 0755
busctl File 94.59 KB 0755
busybox File 2.03 MB 0755
byobu File 8.5 KB 0755
byobu-config File 996 B 0755
byobu-ctrl-a File 4.66 KB 0755
byobu-disable File 1.26 KB 0755
byobu-disable-prompt File 1.31 KB 0755
byobu-enable File 1.15 KB 0755
byobu-enable-prompt File 1.42 KB 0755
byobu-export File 1.39 KB 0755
byobu-janitor File 7.04 KB 0755
byobu-keybindings File 1.47 KB 0755
byobu-launch File 3.25 KB 0755
byobu-launcher File 1.87 KB 0755
byobu-launcher-install File 2.47 KB 0755
byobu-launcher-uninstall File 1.52 KB 0755
byobu-layout File 3.27 KB 0755
byobu-prompt File 1.13 KB 0755
byobu-quiet File 1.38 KB 0755
byobu-reconnect-sockets File 3.22 KB 0755
byobu-screen File 8.5 KB 0755
byobu-select-backend File 1.42 KB 0755
byobu-select-profile File 5.06 KB 0755
byobu-select-session File 1012 B 0755
byobu-shell File 1.66 KB 0755
byobu-silent File 1.28 KB 0755
byobu-status File 5.87 KB 0755
byobu-status-detail File 1.18 KB 0755
byobu-tmux File 8.5 KB 0755
byobu-ugraph File 4.56 KB 0755
byobu-ulevel File 11.71 KB 0755
c_rehash File 6.68 KB 0755
cacaclock File 14.45 KB 0755
cacademo File 278.39 KB 0755
cacafire File 18.3 KB 0755
cacaplay File 14.3 KB 0755
cacaserver File 18.3 KB 0755
cacaview File 22.39 KB 0755
cameratopam File 110.38 KB 0755
captoinfo File 90.41 KB 0755
cat File 38.46 KB 0755
catman File 30.77 KB 0755
certbot File 958 B 0755
cftp3 File 224 B 0755
cgi-fcgi File 18.15 KB 0755
chafa File 170.23 KB 0755
chage File 70.49 KB 2755
chardet File 221 B 0755
chardetect File 221 B 0755
chattr File 14.31 KB 0755
chcon File 58.51 KB 0755
checkgid File 14.3 KB 0755
chfn File 71.09 KB 4755
chgrp File 58.51 KB 0755
chmod File 54.51 KB 0755
choom File 22.38 KB 0755
chown File 58.51 KB 0755
chrt File 30.38 KB 0755
chsh File 43.71 KB 4755
chvt File 14.37 KB 0755
cifsiostat File 26.45 KB 0755
cistopbm File 14.3 KB 0755
ckbcomp File 147.14 KB 0755
ckeygen3 File 227 B 0755
cksum File 102.52 KB 0755
clear File 14.31 KB 0755
clear_console File 14.23 KB 0755
cmp File 42.39 KB 0755
cmuwmtopbm File 14.3 KB 0755
codepage File 14.3 KB 0755
col File 22.38 KB 0755
col1 File 963 B 0755
col2 File 963 B 0755
col3 File 963 B 0755
col4 File 963 B 0755
col5 File 963 B 0755
col6 File 963 B 0755
col7 File 963 B 0755
col8 File 963 B 0755
col9 File 963 B 0755
colcrt File 14.38 KB 0755
colrm File 14.38 KB 0755
column File 38.38 KB 0755
comm File 38.52 KB 0755
compare File 14.31 KB 0755
compare-im6 File 14.31 KB 0755
compare-im6.q16 File 14.31 KB 0755
composite File 14.31 KB 0755
composite-im6 File 14.31 KB 0755
composite-im6.q16 File 14.31 KB 0755
conch3 File 225 B 0755
conjure File 14.31 KB 0755
conjure-im6 File 14.31 KB 0755
conjure-im6.q16 File 14.31 KB 0755
convert File 14.31 KB 0755
convert-im6 File 14.31 KB 0755
convert-im6.q16 File 14.31 KB 0755
corelist File 15.01 KB 0755
cp File 138.52 KB 0755
cpan File 8.16 KB 0755
cpan5.38-x86_64-linux-gnu File 8.18 KB 0755
cpio File 137.67 KB 0755
cpupower File 1.58 KB 0755
crontab File 38.73 KB 2755
csplit File 50.51 KB 0755
ctail File 960 B 0755
ctstat File 22.66 KB 0755
curl File 290.32 KB 0755
cut File 38.51 KB 0755
cvtsudoers File 321.1 KB 0755
dash File 126.74 KB 0755
date File 106.51 KB 0755
dbilogstrip File 1.35 KB 0755
dbiprof File 6.06 KB 0755
dbiproxy File 5.27 KB 0755
dbus-cleanup-sockets File 14.29 KB 0755
dbus-daemon File 230.64 KB 0755
dbus-monitor File 26.3 KB 0755
dbus-run-session File 14.3 KB 0755
dbus-send File 30.29 KB 0755
dbus-update-activation-environment File 14.29 KB 0755
dbus-uuidgen File 14.29 KB 0755
dbxtool File 30.3 KB 0755
dd File 70.54 KB 0755
ddbugtopbm File 14.3 KB 0755
deallocvt File 14.37 KB 0755
deb-systemd-helper File 23.79 KB 0755
deb-systemd-invoke File 6.97 KB 0755
debconf File 2.8 KB 0755
debconf-apt-progress File 11.57 KB 0755
debconf-communicate File 623 B 0755
debconf-copydb File 1.68 KB 0755
debconf-escape File 668 B 0755
debconf-set-selections File 3.14 KB 0755
debconf-show File 1.78 KB 0755
debian-distro-info File 30.95 KB 0755
delpart File 14.38 KB 0755
delv File 45.32 KB 0755
df File 87.08 KB 0755
dh_bash-completion File 4.42 KB 0755
dh_installxmlcatalogs File 9.22 KB 0755
dh_perl_dbi File 1.17 KB 0755
diff File 134.55 KB 0755
diff3 File 58.52 KB 0755
dig File 150.83 KB 0755
dir File 138.98 KB 0755
dircolors File 46.52 KB 0755
dirmngr File 473.77 KB 0755
dirmngr-client File 54.92 KB 0755
dirname File 34.38 KB 0755
display File 14.31 KB 0755
display-im6 File 14.31 KB 0755
display-im6.q16 File 14.31 KB 0755
distro-info File 26.89 KB 0755
dmesg File 68.64 KB 0755
dnsdomainname File 22.23 KB 0755
dnssec-cds File 51.39 KB 0755
dnssec-dsfromkey File 38.38 KB 0755
dnssec-importkey File 38.38 KB 0755
dnssec-keyfromlabel File 42.38 KB 0755
dnssec-keygen File 46.38 KB 0755
dnssec-revoke File 30.38 KB 0755
dnssec-settime File 46.38 KB 0755
dnssec-signzone File 90.41 KB 0755
dnssec-verify File 30.39 KB 0755
do-release-upgrade File 10.42 KB 0755
domainname File 22.23 KB 0755
dpkg File 310.72 KB 0755
dpkg-deb File 142.58 KB 0755
dpkg-divert File 118.57 KB 0755
dpkg-maintscript-helper File 20.71 KB 0755
dpkg-query File 134.56 KB 0755
dpkg-realpath File 4.09 KB 0755
dpkg-split File 98.53 KB 0755
dpkg-statoverride File 50.38 KB 0755
dpkg-trigger File 42.53 KB 0755
du File 98.51 KB 0755
dumpkeys File 162.85 KB 0755
dvipdf File 1007 B 0755
ec2metadata File 8.38 KB 0755
echo File 34.38 KB 0755
ed File 58.55 KB 0755
editor File 272.5 KB 0755
egrep File 41 B 0755
eject File 42.23 KB 0755
enc2xs File 40.96 KB 0755
encguess File 3 KB 0755
env File 46.95 KB 0755
envsubst File 34.38 KB 0755
eps2eps File 639 B 0755
eqn File 188.45 KB 0755
escp2topbm File 14.3 KB 0755
ex File 3.94 MB 0755
expand File 34.53 KB 0755
expiry File 26.52 KB 2755
expr File 42.41 KB 0755
eyuvtoppm File 14.3 KB 0755
factor File 62.51 KB 0755
fail2ban-client File 1.39 KB 0755
fail2ban-python File 7.65 MB 0755
fail2ban-regex File 1.25 KB 0755
fail2ban-server File 1.38 KB 0755
fail2ban-testcases File 2.23 KB 0755
faillog File 22.63 KB 0755
fallocate File 26.38 KB 0755
false File 26.3 KB 0755
fc-cache File 22.38 KB 0755
fc-cat File 18.38 KB 0755
fc-conflist File 14.38 KB 0755
fc-list File 14.38 KB 0755
fc-match File 14.38 KB 0755
fc-pattern File 14.38 KB 0755
fc-query File 14.38 KB 0755
fc-scan File 14.38 KB 0755
fc-validate File 14.38 KB 0755
fcgistarter File 14.3 KB 0755
fgconsole File 14.37 KB 0755
fgrep File 41 B 0755
fiascotopnm File 95.15 KB 0755
figlet File 26.68 KB 0755
figlet-toilet File 26.68 KB 0755
filan File 50.48 KB 0755
file File 30.6 KB 0755
finalrd File 2.06 KB 0755
find File 199.48 KB 0755
findmnt File 67.66 KB 0755
fitstopnm File 18.3 KB 0755
flock File 22.48 KB 0755
fmt File 38.51 KB 0755
fold File 34.51 KB 0755
fonttosfnt File 38.16 KB 0755
free File 26.38 KB 0755
fstopgm File 14.3 KB 0755
ftp File 182.9 KB 0755
funzip File 26.3 KB 0755
fuser File 39.34 KB 0755
fusermount File 38.38 KB 4755
fusermount3 File 38.38 KB 4755
fwupdmgr File 118.3 KB 0755
fwupdtool File 110.3 KB 0755
g3topbm File 19.13 KB 0755
galera_new_cluster File 917 B 0755
galera_recovery File 3.29 KB 0755
gapplication File 22.38 KB 0755
gawk File 722.5 KB 0755
gawkbug File 6.74 KB 0755
gdbus File 50.38 KB 0755
gdk-pixbuf-csource File 14.33 KB 0755
gdk-pixbuf-pixdata File 14.31 KB 0755
gdk-pixbuf-thumbnailer File 18.39 KB 0755
gemtopbm File 14.3 KB 0755
gemtopnm File 14.3 KB 0755
gencat File 26.44 KB 0755
geoiplookup File 18.3 KB 0755
geoiplookup6 File 14.3 KB 0755
geqn File 188.45 KB 0755
getconf File 26.36 KB 0755
getent File 38.72 KB 0755
getkeycodes File 14.37 KB 0755
getopt File 22.38 KB 0755
gettext File 34.38 KB 0755
gettext.sh File 5.07 KB 0755
ghostscript File 14.15 KB 0755
giftopnm File 26.3 KB 0755
ginstall-info File 47.24 KB 0755
gio File 102.4 KB 0755
gio-querymodules File 18.3 KB 0755
git File 3.88 MB 0755
git-receive-pack File 3.88 MB 0755
git-shell File 624.81 KB 0755
git-upload-archive File 3.88 MB 0755
git-upload-pack File 3.88 MB 0755
glib-compile-schemas File 54.3 KB 0755
gouldtoppm File 14.3 KB 0755
gpasswd File 74.46 KB 4755
gpg File 1.09 MB 0755
gpg-agent File 357.52 KB 0755
gpg-connect-agent File 87.3 KB 0755
gpg-wks-client File 139.37 KB 0755
gpgconf File 115.36 KB 0755
gpgparsemail File 34.38 KB 0755
gpgsm File 501.37 KB 0755
gpgsplit File 26.62 KB 0755
gpgtar File 67.83 KB 0755
gpgv File 303.14 KB 0755
gpic File 196.06 KB 0755
gpu-manager File 78.82 KB 0755
grep File 182.45 KB 0755
gresource File 22.3 KB 0755
groff File 94.51 KB 0755
grog File 18.75 KB 0755
grops File 162.55 KB 0755
grotty File 118.51 KB 0755
groups File 34.51 KB 0755
growpart File 29.19 KB 0755
grub-editenv File 393.16 KB 0755
grub-file File 741.88 KB 0755
grub-fstest File 863.32 KB 0755
grub-glue-efi File 102.88 KB 0755
grub-kbdcomp File 1.64 KB 0755
grub-menulst2cfg File 83.2 KB 0755
grub-mkfont File 131.45 KB 0755
grub-mkimage File 377.26 KB 0755
grub-mklayout File 103.23 KB 0755
grub-mknetdir File 429.77 KB 0755
grub-mkpasswd-pbkdf2 File 111.32 KB 0755
grub-mkrelpath File 259.79 KB 0755
grub-mkrescue File 1019.84 KB 0755
grub-mkstandalone File 510.16 KB 0755
grub-mount File 682.21 KB 0755
grub-ntldr-img File 38.39 KB 0755
grub-render-label File 750.23 KB 0755
grub-script-check File 126.76 KB 0755
grub-syslinux2cfg File 698.71 KB 0755
gs File 14.15 KB 0755
gsbj File 350 B 0755
gsdj File 352 B 0755
gsdj500 File 352 B 0755
gsettings File 30.3 KB 0755
gslj File 353 B 0755
gslp File 350 B 0755
gsnd File 277 B 0755
gtbl File 134.48 KB 0755
gunzip File 2.29 KB 0755
gzexe File 6.3 KB 0755
gzip File 91.23 KB 0755
h2ph File 28.54 KB 0755
h2xs File 59.51 KB 0755
hardlink File 46.48 KB 0755
hd File 46.39 KB 0755
hdifftopam File 14.3 KB 0755
head File 42.51 KB 0755
helpztags File 2.46 KB 0755
hexdump File 46.39 KB 0755
hipstopgm File 14.3 KB 0755
host File 118.82 KB 0755
hostid File 34.51 KB 0755
hostname File 22.23 KB 0755
hostnamectl File 30.45 KB 0755
hpcdtoppm File 798 B 0755
htcacheclean File 34.31 KB 0755
htdbm File 26.3 KB 0755
htdigest File 14.3 KB 0755
htop File 370.33 KB 0755
htpasswd File 26.3 KB 0755
hwe-support-status File 11.24 KB 0755
i386 File 26.65 KB 0755
icontopbm File 14.3 KB 0755
iconv File 66.48 KB 0755
id File 38.51 KB 0755
identify File 14.31 KB 0755
identify-im6 File 14.31 KB 0755
identify-im6.q16 File 14.31 KB 0755
ilbmtoppm File 38.38 KB 0755
imagetops File 1.21 KB 0755
img2sixel File 26.3 KB 0755
img2txt File 18.66 KB 0755
imgtoppm File 14.3 KB 0755
import File 14.31 KB 0755
import-im6 File 14.31 KB 0755
import-im6.q16 File 14.31 KB 0755
inetutils-telnet File 177.85 KB 0755
info File 241.73 KB 0755
infobrowser File 241.73 KB 0755
infocmp File 66.38 KB 0755
infotocap File 90.41 KB 0755
infotopam File 18.3 KB 0755
innochecksum File 4.57 MB 0755
innotop File 445.71 KB 0755
install File 142.52 KB 0755
install-info File 47.24 KB 0755
instmodsh File 4.27 KB 0755
ionice File 18.38 KB 0755
iostat File 54.44 KB 0755
ip File 754.8 KB 0755
ipcmk File 22.45 KB 0755
ipcrm File 18.38 KB 0755
ipcs File 38.38 KB 0755
iptables-xml File 92.95 KB 0755
ischroot File 14.48 KB 0755
iscsiadm File 370.43 KB 0755
jbigtopnm File 57.14 KB 0755
join File 50.55 KB 0755
journalctl File 78.91 KB 0755
jp2a File 50.75 KB 0755
jpeg2ktopam File 208.82 KB 0755
jpegtopnm File 38.38 KB 0755
jq File 30.15 KB 0755
json_pp File 4.88 KB 0755
kbd_mode File 14.66 KB 0755
kbdinfo File 18.37 KB 0755
kbxutil File 62.83 KB 0755
keep-one-running File 3.51 KB 0755
kernel-install File 54.67 KB 0755
kill File 22.38 KB 0755
killall File 31.34 KB 0755
kmod File 170.24 KB 0755
kmodsign File 18.45 KB 0755
landscape-sysinfo File 646 B 0755
last File 34.38 KB 0755
lastb File 34.38 KB 0755
lastlog File 27.79 KB 0755
lcf File 7.6 KB 0755
ld.so File 231.07 KB 0755
ldd File 5.26 KB 0755
leaftoppm File 14.3 KB 0755
less File 190.38 KB 0755
lessecho File 14.31 KB 0755
lessfile File 8.83 KB 0755
lesskey File 23.7 KB 0755
lesspipe File 8.83 KB 0755
letsencrypt File 958 B 0755
lexgrog File 99.51 KB 0755
libnetcfg File 15.41 KB 0755
libsixel-config File 1.81 KB 0755
link File 34.51 KB 0755
linux-boot-prober File 1.54 KB 0755
linux-check-removal File 3.99 KB 0755
linux-update-symlinks File 6.17 KB 0755
linux-version File 2.63 KB 0755
linux32 File 26.65 KB 0755
linux64 File 26.65 KB 0755
lispmtopgm File 14.3 KB 0755
ln File 54.51 KB 0755
lnstat File 22.66 KB 0755
loadkeys File 202.9 KB 0755
loadunimap File 34.46 KB 0755
locale File 49.63 KB 0755
locale-check File 14.15 KB 0755
localectl File 26.45 KB 0755
localedef File 319.09 KB 0755
logger File 38.97 KB 0755
login File 51.81 KB 0755
loginctl File 66.58 KB 0755
logname File 34.51 KB 0755
logresolve File 14.31 KB 0755
look File 18.38 KB 0755
lowntfs-3g File 118.98 KB 0755
ls File 138.98 KB 0755
lsattr File 14.31 KB 0755
lsb_release File 2.59 KB 0755
lsblk File 146.38 KB 0755
lscpu File 110.38 KB 0755
lshw File 957.2 KB 0755
lsinitramfs File 735 B 0755
lsipc File 50.38 KB 0755
lslocks File 30.77 KB 0755
lslogins File 50.38 KB 0755
lsmem File 38.38 KB 0755
lsmod File 170.24 KB 0755
lsns File 42.38 KB 0755
lsof File 171.66 KB 0755
lspci File 100.11 KB 0755
lspgpot File 1.06 KB 0755
lspower File 1.18 KB 0755
lsusb File 246.52 KB 0755
lzcat File 86.92 KB 0755
lzcmp File 7.25 KB 0755
lzdiff File 7.25 KB 0755
lzegrep File 10.09 KB 0755
lzfgrep File 10.09 KB 0755
lzgrep File 10.09 KB 0755
lzless File 1.77 KB 0755
lzma File 86.92 KB 0755
lzmainfo File 14.38 KB 0755
lzmore File 2.14 KB 0755
macptopbm File 14.3 KB 0755
mailmail3 File 227 B 0755
man File 125.41 KB 0755
man-recode File 35.4 KB 0755
mandb File 143.67 KB 0755
manifest File 1.9 KB 0755
manpath File 26.78 KB 0755
mapscrn File 30.46 KB 0755
mariadb File 5.07 MB 0755
mariadb-access File 109.31 KB 0755
mariadb-admin File 4.85 MB 0755
mariadb-analyze File 4.84 MB 0755
mariadb-binlog File 5.13 MB 0755
mariadb-check File 4.84 MB 0755
mariadb-conv File 4.56 MB 0755
mariadb-convert-table-format File 4.12 KB 0755
mariadb-dump File 4.93 MB 0755
mariadb-dumpslow File 8.05 KB 0755
mariadb-find-rows File 3.21 KB 0755
mariadb-fix-extensions File 1.22 KB 0755
mariadb-hotcopy File 34.53 KB 0755
mariadb-import File 4.83 MB 0755
mariadb-install-db File 22.13 KB 0755
mariadb-optimize File 4.84 MB 0755
mariadb-plugin File 4.54 MB 0755
mariadb-repair File 4.84 MB 0755
mariadb-report File 49.02 KB 0755
mariadb-secure-installation File 13.49 KB 0755
mariadb-service-convert File 2.45 KB 0755
mariadb-setpermission File 17.56 KB 0755
mariadb-show File 4.83 MB 0755
mariadb-slap File 4.85 MB 0755
mariadb-tzinfo-to-sql File 4.53 MB 0755
mariadb-upgrade File 4.97 MB 0755
mariadb-waitpid File 4.53 MB 0755
mariadbcheck File 4.84 MB 0755
mariadbd-multi File 26.69 KB 0755
mariadbd-safe File 30.42 KB 0755
mariadbd-safe-helper File 4.49 MB 0755
markdown-it File 220 B 0755
mawk File 166.77 KB 0755
mbim-network File 11.08 KB 0755
mbimcli File 216.74 KB 0755
mcookie File 26.45 KB 0755
md5sum File 38.41 KB 0755
md5sum.textutils File 38.41 KB 0755
mdatopbm File 14.3 KB 0755
mdig File 50.4 KB 0755
memhog File 14.42 KB 0755
memusage File 7.32 KB 0755
memusagestat File 22.44 KB 0755
mesg File 14.38 KB 0755
mgrtopbm File 14.3 KB 0755
migrate-pubring-from-classic-gpg File 3.02 KB 0755
migratepages File 14.38 KB 0755
migspeed File 14.3 KB 0755
mk_modmap File 15.78 KB 0755
mkdir File 74.51 KB 0755
mkfifo File 42.51 KB 0755
mkfontdir File 65 B 0755
mkfontscale File 42.67 KB 0755
mknod File 42.51 KB 0755
mkpasswd File 26.38 KB 0755
mksquashfs File 286.95 KB 0755
mktemp File 34.51 KB 0755
mmcli File 273.94 KB 0755
mogrify File 14.31 KB 0755
mogrify-im6 File 14.31 KB 0755
mogrify-im6.q16 File 14.31 KB 0755
montage File 14.31 KB 0755
montage-im6 File 14.31 KB 0755
montage-im6.q16 File 14.31 KB 0755
more File 46.38 KB 0755
mount File 50.38 KB 4755
mountpoint File 18.38 KB 0755
mpstat File 50.45 KB 0755
mrftopbm File 14.3 KB 0755
msql2mysql File 1.41 KB 0755
mt File 70.73 KB 0755
mt-gnu File 70.73 KB 0755
mtr File 76.25 KB 0755
mtr-packet File 34.3 KB 0755
mtrace File 6.37 KB 0755
mtvtoppm File 14.3 KB 0755
mv File 134.52 KB 0755
my_print_defaults File 4.53 MB 0755
myisam_ftdump File 4.87 MB 0755
myisamchk File 4.99 MB 0755
myisamlog File 4.85 MB 0755
myisampack File 4.9 MB 0755
mysql File 5.07 MB 0755
mysql_convert_table_format File 4.12 KB 0755
mysql_find_rows File 3.21 KB 0755
mysql_fix_extensions File 1.22 KB 0755
mysql_install_db File 22.13 KB 0755
mysql_plugin File 4.54 MB 0755
mysql_secure_installation File 13.49 KB 0755
mysql_setpermission File 17.56 KB 0755
mysql_tzinfo_to_sql File 4.53 MB 0755
mysql_upgrade File 4.97 MB 0755
mysql_waitpid File 4.53 MB 0755
mysqlaccess File 109.31 KB 0755
mysqladmin File 4.85 MB 0755
mysqlanalyze File 4.84 MB 0755
mysqlbinlog File 5.13 MB 0755
mysqlcheck File 4.84 MB 0755
mysqld_multi File 26.69 KB 0755
mysqld_safe File 30.42 KB 0755
mysqld_safe_helper File 4.49 MB 0755
mysqldump File 4.93 MB 0755
mysqldumpslow File 8.05 KB 0755
mysqlhotcopy File 34.53 KB 0755
mysqlimport File 4.83 MB 0755
mysqloptimize File 4.84 MB 0755
mysqlrepair File 4.84 MB 0755
mysqlreport File 49.02 KB 0755
mysqlshow File 4.83 MB 0755
mysqlslap File 4.85 MB 0755
mytop File 71.95 KB 0755
named-checkconf File 38.4 KB 0755
named-checkzone File 30.4 KB 0755
named-compilezone File 30.4 KB 0755
named-journalprint File 14.3 KB 0755
named-nzd2nzf File 14.3 KB 0755
named-rrchecker File 22.3 KB 0755
namei File 22.38 KB 0755
nano File 272.5 KB 0755
nawk File 722.5 KB 0755
nc File 38.63 KB 0755
nc.openbsd File 38.63 KB 0755
neofetch File 333.58 KB 0755
neotoppm File 14.3 KB 0755
neqn File 913 B 0755
netaddr File 959 B 0755
netcat File 38.63 KB 0755
networkctl File 122.58 KB 0755
networkd-dispatcher File 19.88 KB 0755
newgrp File 39.71 KB 4755
ngettext File 34.38 KB 0755
nice File 34.51 KB 0755
nisdomainname File 22.23 KB 0755
nl File 38.6 KB 0755
nohup File 34.41 KB 0755
nproc File 34.51 KB 0755
nroff File 5.58 KB 0755
nsec3hash File 14.3 KB 0755
nsenter File 30.6 KB 0755
nslookup File 122.82 KB 0755
nstat File 30.38 KB 0755
nsupdate File 74.55 KB 0755
ntfs-3g File 159.01 KB 0755
ntfs-3g.probe File 14.38 KB 0755
ntfscat File 26.38 KB 0755
ntfscluster File 38.38 KB 0755
ntfscmp File 30.38 KB 0755
ntfsdecrypt File 42.38 KB 0755
ntfsfallocate File 26.38 KB 0755
ntfsfix File 34.38 KB 0755
ntfsinfo File 54.38 KB 0755
ntfsls File 27.45 KB 0755
ntfsmove File 30.38 KB 0755
ntfsrecover File 102.38 KB 0755
ntfssecaudit File 78.86 KB 0755
ntfstruncate File 26.3 KB 0755
ntfsusermap File 18.3 KB 0755
ntfswipe File 46.91 KB 0755
numactl File 35.23 KB 0755
numastat File 35.56 KB 0755
numfmt File 58.54 KB 0755
nvidia-detector File 270 B 0755
od File 70.51 KB 0755
oem-getlogs File 8.3 KB 0755
on_ac_power File 3.7 KB 0755
openssl File 981.8 KB 0755
openvt File 22.73 KB 0755
os-prober File 4.42 KB 0755
pager File 190.38 KB 0755
palmtopnm File 26.3 KB 0755
pamaddnoise File 18.3 KB 0755
pamaltsat File 14.34 KB 0755
pamarith File 22.3 KB 0755
pambackground File 18.3 KB 0755
pambayer File 14.38 KB 0755
pambrighten File 14.3 KB 0755
pamcat File 22.3 KB 0755
pamchannel File 14.3 KB 0755
pamcomp File 18.3 KB 0755
pamcrater File 18.3 KB 0755
pamcut File 18.3 KB 0755
pamdeinterlace File 14.3 KB 0755
pamdepth File 14.3 KB 0755
pamdice File 18.3 KB 0755
pamditherbw File 26.3 KB 0755
pamedge File 14.3 KB 0755
pamendian File 14.3 KB 0755
pamenlarge File 18.38 KB 0755
pamexec File 14.3 KB 0755
pamfile File 14.3 KB 0755
pamfind File 14.3 KB 0755
pamfix File 14.3 KB 0755
pamfixtrunc File 2.01 KB 0755
pamflip File 22.3 KB 0755
pamfunc File 18.3 KB 0755
pamgauss File 14.3 KB 0755
pamgetcolor File 18.38 KB 0755
pamgradient File 14.3 KB 0755
pamhomography File 18.3 KB 0755
pamhue File 14.3 KB 0755
pamlevels File 18.3 KB 0755
pamlookup File 14.3 KB 0755
pammasksharpen File 14.3 KB 0755
pammixinterlace File 14.38 KB 0755
pammixmulti File 18.3 KB 0755
pammosaicknit File 14.3 KB 0755
pamoil File 14.3 KB 0755
pampaintspill File 18.3 KB 0755
pamperspective File 30.38 KB 0755
pampick File 14.3 KB 0755
pampop9 File 14.3 KB 0755
pamrecolor File 18.3 KB 0755
pamrestack File 14.3 KB 0755
pamrgbatopng File 34.3 KB 0755
pamrubber File 34.3 KB 0755
pamscale File 34.38 KB 0755
pamseq File 14.3 KB 0755
pamshadedrelief File 14.3 KB 0755
pamsharpmap File 14.3 KB 0755
pamsharpness File 14.3 KB 0755
pamshuffle File 14.3 KB 0755
pamsistoaglyph File 14.3 KB 0755
pamslice File 14.3 KB 0755
pamsplit File 14.3 KB 0755
pamstack File 14.3 KB 0755
pamstereogram File 30.3 KB 0755
pamstretch File 14.3 KB 0755
pamstretch-gen File 3.83 KB 0755
pamsumm File 14.3 KB 0755
pamsummcol File 14.3 KB 0755
pamtable File 14.3 KB 0755
pamthreshold File 18.3 KB 0755
pamtilt File 18.3 KB 0755
pamtoavs File 14.3 KB 0755
pamtodjvurle File 14.3 KB 0755
pamtofits File 14.3 KB 0755
pamtogif File 26.3 KB 0755
pamtohdiff File 14.3 KB 0755
pamtohtmltbl File 14.3 KB 0755
pamtojpeg2k File 212.82 KB 0755
pamtompfont File 14.3 KB 0755
pamtooctaveimg File 14.3 KB 0755
pamtopam File 14.3 KB 0755
pamtopdbimg File 18.38 KB 0755
pamtopfm File 14.3 KB 0755
pamtopng File 34.3 KB 0755
pamtopnm File 14.3 KB 0755
pamtoqoi File 18.3 KB 0755
pamtosrf File 18.3 KB 0755
pamtosvg File 70.15 KB 0755
pamtotga File 18.3 KB 0755
pamtotiff File 46.38 KB 0755
pamtouil File 14.3 KB 0755
pamtowinicon File 18.3 KB 0755
pamtoxvmini File 14.3 KB 0755
pamtris File 26.3 KB 0755
pamundice File 18.3 KB 0755
pamunlookup File 14.3 KB 0755
pamvalidate File 14.3 KB 0755
pamwipeout File 14.3 KB 0755
pamx File 42.38 KB 0755
paperconf File 14.15 KB 0755
partx File 62.38 KB 0755
passwd File 62.65 KB 4755
paste File 38.41 KB 0755
pastebinit File 16.31 KB 0755
patch File 182.52 KB 0755
pathchk File 34.51 KB 0755
pbget File 2.51 KB 0755
pbmclean File 18.3 KB 0755
pbmlife File 14.3 KB 0755
pbmmake File 14.3 KB 0755
pbmmask File 14.3 KB 0755
pbmminkowski File 14.3 KB 0755
pbmnoise File 14.3 KB 0755
pbmpage File 14.3 KB 0755
pbmpscale File 14.3 KB 0755
pbmreduce File 14.3 KB 0755
pbmtext File 30.48 KB 0755
pbmtextps File 22.3 KB 0755
pbmto10x File 14.3 KB 0755
pbmto4425 File 14.3 KB 0755
pbmtoascii File 14.3 KB 0755
pbmtoatk File 14.3 KB 0755
pbmtobbnbg File 14.3 KB 0755
pbmtocis File 14.3 KB 0755
pbmtocmuwm File 14.3 KB 0755
pbmtodjvurle File 14.3 KB 0755
pbmtoepsi File 14.3 KB 0755
pbmtoepson File 14.3 KB 0755
pbmtoescp2 File 14.3 KB 0755
pbmtog3 File 19.13 KB 0755
pbmtogem File 14.3 KB 0755
pbmtogo File 14.3 KB 0755
pbmtoibm23xx File 14.3 KB 0755
pbmtoicon File 14.3 KB 0755
pbmtolj File 18.3 KB 0755
pbmtoln03 File 14.3 KB 0755
pbmtolps File 14.3 KB 0755
pbmtomacp File 14.3 KB 0755
pbmtomatrixorbital File 14.3 KB 0755
pbmtomda File 14.3 KB 0755
pbmtomgr File 14.3 KB 0755
pbmtomrf File 14.3 KB 0755
pbmtonokia File 14.3 KB 0755
pbmtopgm File 14.3 KB 0755
pbmtopi3 File 14.3 KB 0755
pbmtopk File 26.6 KB 0755
pbmtoplot File 14.3 KB 0755
pbmtoppa File 30.38 KB 0755
pbmtopsg3 File 15.94 KB 0755
pbmtoptx File 14.3 KB 0755
pbmtosunicon File 14.3 KB 0755
pbmtowbmp File 14.3 KB 0755
pbmtox10bm File 2.83 KB 0755
pbmtoxbm File 14.3 KB 0755
pbmtoybm File 14.3 KB 0755
pbmtozinc File 14.3 KB 0755
pbmupc File 22.3 KB 0755
pbput File 2.51 KB 0755
pbputs File 2.51 KB 0755
pc1toppm File 14.3 KB 0755
pcdindex File 6.56 KB 0755
pcdovtoppm File 6.56 KB 0755
pcxtoppm File 18.3 KB 0755
pdb3 File 67.83 KB 0755
pdb3.12 File 67.83 KB 0755
pdbimgtopam File 18.38 KB 0755
pdf2dsc File 698 B 0755
pdf2ps File 909 B 0755
pear File 793 B 0755
peardev File 814 B 0755
pecl File 727 B 0755
peekfd File 14.3 KB 0755
perf File 1.58 KB 0755
perl File 3.83 MB 0755
perl5.38-x86_64-linux-gnu File 14.3 KB 0755
perl5.38.2 File 3.83 MB 0755
perlbug File 44.52 KB 0755
perldoc File 125 B 0755
perlivp File 10.61 KB 0755
perlthanks File 44.52 KB 0755
perror File 4.72 MB 0755
pf2afm File 498 B 0755
pfbtopfa File 516 B 0755
pfmtopam File 14.3 KB 0755
pgmabel File 18.3 KB 0755
pgmbentley File 14.3 KB 0755
pgmcrater File 3.49 KB 0755
pgmdeshadow File 14.3 KB 0755
pgmedge File 14.3 KB 0755
pgmenhance File 14.3 KB 0755
pgmhist File 18.3 KB 0755
pgmkernel File 14.3 KB 0755
pgmmake File 14.3 KB 0755
pgmmedian File 18.3 KB 0755
pgmminkowski File 14.3 KB 0755
pgmmorphconv File 14.3 KB 0755
pgmnoise File 14.3 KB 0755
pgmnorm File 18.3 KB 0755
pgmoil File 14.3 KB 0755
pgmramp File 14.3 KB 0755
pgmslice File 14.3 KB 0755
pgmtexture File 26.3 KB 0755
pgmtofs File 14.3 KB 0755
pgmtolispm File 14.3 KB 0755
pgmtopbm File 22.3 KB 0755
pgmtopgm File 14.3 KB 0755
pgmtoppm File 14.3 KB 0755
pgmtosbig File 14.3 KB 0755
pgmtost4 File 14.3 KB 0755
pgrep File 34.47 KB 0755
phar File 14.84 KB 0755
phar.phar File 14.84 KB 0755
phar.phar8.3 File 14.84 KB 0755
phar8.3 File 14.84 KB 0755
phar8.3.phar File 14.84 KB 0755
php File 5.52 MB 0755
php8.3 File 5.52 MB 0755
pi1toppm File 14.3 KB 0755
pi3topbm File 14.3 KB 0755
pic File 196.06 KB 0755
pico File 272.5 KB 0755
piconv File 8.16 KB 0755
pidof File 26.23 KB 0755
pidstat File 50.45 KB 0755
pidwait File 34.47 KB 0755
pinentry File 58.65 KB 0755
pinentry-curses File 58.65 KB 0755
ping File 87.7 KB 0755
ping4 File 87.7 KB 0755
ping6 File 87.7 KB 0755
pinky File 38.41 KB 0755
pjtoppm File 18.3 KB 0755
pkaction File 18.3 KB 0755
pkcheck File 22.3 KB 0755
pkcon File 54.3 KB 0755
pkill File 34.47 KB 0755
pkmon File 22.3 KB 0755
pktopbm File 18.3 KB 0755
pkttyagent File 22.3 KB 0755
pl2pm File 4.43 KB 0755
pldd File 22.44 KB 0755
plymouth File 46.3 KB 0755
pmap File 34.4 KB 0755
pngtopam File 34.38 KB 0755
pngtopnm File 34.38 KB 0755
pnmalias File 18.3 KB 0755
pnmarith File 22.3 KB 0755
pnmcat File 22.3 KB 0755
pnmcolormap File 18.3 KB 0755
pnmcomp File 18.3 KB 0755
pnmconvol File 34.3 KB 0755
pnmcrop File 26.38 KB 0755
pnmcut File 18.3 KB 0755
pnmdepth File 14.3 KB 0755
pnmenlarge File 18.38 KB 0755
pnmfile File 14.3 KB 0755
pnmflip File 3.63 KB 0755
pnmgamma File 18.3 KB 0755
pnmhisteq File 14.3 KB 0755
pnmhistmap File 18.3 KB 0755
pnmindex File 18.3 KB 0755
pnminterp File 14.3 KB 0755
pnminterp-gen File 3.83 KB 0755
pnminvert File 14.3 KB 0755
pnmmargin File 2.42 KB 0755
pnmmercator File 14.3 KB 0755
pnmmontage File 18.3 KB 0755
pnmnlfilt File 22.36 KB 0755
pnmnoraw File 31 B 0755
pnmnorm File 18.3 KB 0755
pnmpad File 22.3 KB 0755
pnmpaste File 18.3 KB 0755
pnmpsnr File 18.3 KB 0755
pnmquant File 10.63 KB 0755
pnmquantall File 6.84 KB 0755
pnmremap File 18.3 KB 0755
pnmrotate File 18.3 KB 0755
pnmscale File 34.38 KB 0755
pnmscalefixed File 18.3 KB 0755
pnmshear File 14.3 KB 0755
pnmsmooth File 14.3 KB 0755
pnmsplit File 14.3 KB 0755
pnmstitch File 34.97 KB 0755
pnmtile File 14.3 KB 0755
pnmtoddif File 18.3 KB 0755
pnmtofiasco File 164.21 KB 0755
pnmtofits File 14.3 KB 0755
pnmtojbig File 61.14 KB 0755
pnmtojpeg File 26.3 KB 0755
pnmtopalm File 26.3 KB 0755
pnmtopclxl File 22.81 KB 0755
pnmtoplainpnm File 31 B 0755
pnmtopng File 54.3 KB 0755
pnmtopnm File 14.3 KB 0755
pnmtops File 34.3 KB 0755
pnmtorast File 18.3 KB 0755
pnmtorle File 34.55 KB 0755
pnmtosgi File 14.3 KB 0755
pnmtosir File 14.3 KB 0755
pnmtotiff File 46.38 KB 0755
pnmtotiffcmyk File 38.38 KB 0755
pnmtoxwd File 18.3 KB 0755
pod2html File 3.95 KB 0755
pod2man File 18.46 KB 0755
pod2text File 12.8 KB 0755
pod2usage File 4.01 KB 0755
podchecker File 3.57 KB 0755
pollinate File 8.54 KB 0755
pphs File 404 B 0755
ppm3d File 18.3 KB 0755
ppmbrighten File 2 KB 0755
ppmchange File 14.3 KB 0755
ppmcie File 26.47 KB 0755
ppmcolormask File 14.3 KB 0755
ppmcolors File 14.3 KB 0755
ppmdcfont File 14.3 KB 0755
ppmddumpfont File 14.3 KB 0755
ppmdim File 14.3 KB 0755
ppmdist File 14.3 KB 0755
ppmdither File 14.3 KB 0755
ppmdmkfont File 22.02 KB 0755
ppmdraw File 22.3 KB 0755
ppmfade File 14.76 KB 0755
ppmflash File 14.3 KB 0755
ppmforge File 22.3 KB 0755
ppmglobe File 14.3 KB 0755
ppmhist File 18.3 KB 0755
ppmlabel File 14.3 KB 0755
ppmmake File 14.3 KB 0755
ppmmix File 14.3 KB 0755
ppmnorm File 18.3 KB 0755
ppmntsc File 14.3 KB 0755
ppmpat File 30.3 KB 0755
ppmquant File 2.3 KB 0755
ppmquantall File 6.84 KB 0755
ppmrainbow File 3.48 KB 0755
ppmrelief File 14.3 KB 0755
ppmrough File 18.3 KB 0755
ppmshadow File 10.85 KB 0755
ppmshift File 14.3 KB 0755
ppmspread File 14.3 KB 0755
ppmtoacad File 19.15 KB 0755
ppmtoapplevol File 14.3 KB 0755
ppmtoarbtxt File 18.3 KB 0755
ppmtoascii File 14.38 KB 0755
ppmtobmp File 18.3 KB 0755
ppmtoeyuv File 18.3 KB 0755
ppmtogif File 14.3 KB 0755
ppmtoicr File 14.3 KB 0755
ppmtoilbm File 42.39 KB 0755
ppmtojpeg File 26.3 KB 0755
ppmtoleaf File 14.3 KB 0755
ppmtolj File 14.3 KB 0755
ppmtomap File 82 B 0755
ppmtomitsu File 22.3 KB 0755
ppmtompeg File 494.09 KB 0755
ppmtoneo File 14.3 KB 0755
ppmtopcx File 18.3 KB 0755
ppmtopgm File 18.3 KB 0755
ppmtopi1 File 14.3 KB 0755
ppmtopict File 14.3 KB 0755
ppmtopj File 14.38 KB 0755
ppmtopjxl File 18.38 KB 0755
ppmtoppm File 14.3 KB 0755
ppmtopuzz File 14.3 KB 0755
ppmtorgb3 File 14.3 KB 0755
ppmtosixel File 14.3 KB 0755
ppmtospu File 14.3 KB 0755
ppmtoterm File 14.3 KB 0755
ppmtotga File 18.3 KB 0755
ppmtouil File 14.3 KB 0755
ppmtowinicon File 18.3 KB 0755
ppmtoxpm File 18.3 KB 0755
ppmtoyuv File 14.3 KB 0755
ppmtoyuvsplit File 14.3 KB 0755
ppmtv File 14.3 KB 0755
ppmwheel File 14.3 KB 0755
pr File 70.58 KB 0755
preconv File 58.48 KB 0755
printafm File 395 B 0755
printenv File 34.38 KB 0755
printf File 54.44 KB 0755
prlimit File 26.89 KB 0755
pro File 1003 B 0755
procan File 42.41 KB 0755
prove File 13.34 KB 0755
prtstat File 18.38 KB 0755
ps File 142.99 KB 0755
ps2ascii File 631 B 0755
ps2epsi File 1.23 KB 0755
ps2pdf File 272 B 0755
ps2pdf12 File 215 B 0755
ps2pdf13 File 215 B 0755
ps2pdf14 File 215 B 0755
ps2pdfwr File 1.05 KB 0755
ps2ps File 647 B 0755
ps2ps2 File 669 B 0755
ps2txt File 631 B 0755
psfaddtable File 22.37 KB 0755
psfgettable File 22.37 KB 0755
psfstriptable File 22.37 KB 0755
psfxtable File 22.37 KB 0755
psidtopgm File 14.3 KB 0755
pslog File 14.3 KB 0755
pstopnm File 22.38 KB 0755
pstree File 35.32 KB 0755
pstree.x11 File 35.32 KB 0755
ptar File 3.48 KB 0755
ptardiff File 2.58 KB 0755
ptargrep File 4.29 KB 0755
ptx File 54.54 KB 0755
purge-old-kernels File 1.12 KB 0755
pv File 79.41 KB 0755
pwd File 34.51 KB 0755
pwdx File 14.38 KB 0755
py3clean File 7.63 KB 0755
py3compile File 13 KB 0755
py3versions File 12.52 KB 0755
pydoc3 File 80 B 0755
pydoc3.12 File 80 B 0755
pygettext3 File 23.66 KB 0755
pygettext3.12 File 23.66 KB 0755
pygmentize File 215 B 0755
pyhtmlizer3 File 222 B 0755
pyserial-miniterm File 975 B 0755
pyserial-ports File 969 B 0755
python3 File 7.65 MB 0755
python3.12 File 7.65 MB 0755
pzstd File 690.54 KB 0755
qmi-firmware-update File 168.09 KB 0755
qmi-network File 16.04 KB 0755
qmicli File 586.84 KB 0755
qoitopam File 14.3 KB 0755
qrttoppm File 14.3 KB 0755
quirks-handler File 2.4 KB 0755
rasttopnm File 18.3 KB 0755
rawtopgm File 14.3 KB 0755
rawtoppm File 14.3 KB 0755
rbash File 1.38 MB 0755
rdma File 102.52 KB 0755
readlink File 42.41 KB 0755
realpath File 42.41 KB 0755
red File 89 B 0755
rename.ul File 22.38 KB 0755
renice File 14.38 KB 0755
replace File 4.51 MB 0755
rescan-scsi-bus.sh File 38.05 KB 0755
reset File 26.31 KB 0755
resizecons File 26.46 KB 0755
resizepart File 22.38 KB 0755
resolve_stack_dump File 4.53 MB 0755
resolvectl File 158.67 KB 0755
resolveip File 4.53 MB 0755
rev File 14.38 KB 0755
rgb3toppm File 14.3 KB 0755
rgrep File 30 B 0755
rlatopam File 14.3 KB 0755
rletopnm File 38.55 KB 0755
rm File 58.51 KB 0755
rmdir File 46.41 KB 0755
rnano File 272.5 KB 0755
rotatelogs File 26.38 KB 0755
routel File 1.62 KB 0755
rpcgen File 94.59 KB 0755
rrsync File 12.34 KB 0755
rsync File 502.13 KB 0755
rsync-ssl File 5.02 KB 0755
rtla File 1.58 KB 0755
rtstat File 22.66 KB 0755
run-one File 3.51 KB 0755
run-one-constantly File 3.51 KB 0755
run-one-until-failure File 3.51 KB 0755
run-one-until-success File 3.51 KB 0755
run-parts File 26.82 KB 0755
run-this-one File 3.51 KB 0755
runcon File 34.51 KB 0755
rview File 3.94 MB 0755
rvim File 3.94 MB 0755
sadf File 382.31 KB 0755
sar File 137.38 KB 0755
sar.sysstat File 137.38 KB 0755
savelog File 10.24 KB 0755
sbattach File 22.54 KB 0755
sbigtopgm File 14.3 KB 0755
sbkeysync File 34.74 KB 0755
sbsiglist File 14.6 KB 0755
sbsign File 34.7 KB 0755
sbvarsign File 22.73 KB 0755
sbverify File 30.61 KB 0755
scalar File 668.94 KB 0755
scandeps File 6.47 KB 0755
scp File 134.59 KB 0755
screen File 478.24 KB 0755
screendump File 14.3 KB 0755
script File 54.38 KB 0755
scriptlive File 42.38 KB 0755
scriptreplay File 34.38 KB 0755
scsi_logging_level File 8.38 KB 0755
scsi_mandat File 3.52 KB 0755
scsi_readcap File 1.3 KB 0755
scsi_ready File 1.09 KB 0755
scsi_satl File 3.74 KB 0755
scsi_start File 1.25 KB 0755
scsi_stop File 1.44 KB 0755
scsi_temperature File 936 B 0755
sdiff File 50.39 KB 0755
sed File 110.57 KB 0755
select-editor File 2.39 KB 0755
sensible-browser File 1.55 KB 0755
sensible-editor File 1.52 KB 0755
sensible-pager File 921 B 0755
sensible-terminal File 1.15 KB 0755
seq File 50.51 KB 0755
setarch File 26.65 KB 0755
setfont File 54.46 KB 0755
setkeycodes File 14.37 KB 0755
setleds File 18.43 KB 0755
setlogcons File 14.37 KB 0755
setmetamode File 14.41 KB 0755
setpci File 30.38 KB 0755
setpriv File 38.38 KB 0755
setsid File 14.38 KB 0755
setterm File 34.38 KB 0755
setupcon File 40.06 KB 0755
sftp File 150.66 KB 0755
sg File 39.71 KB 4755
sg_bg_ctl File 14.51 KB 0755
sg_compare_and_write File 26.91 KB 0755
sg_copy_results File 23.3 KB 0755
sg_dd File 54.33 KB 0755
sg_decode_sense File 14.76 KB 0755
sg_emc_trespass File 14.3 KB 0755
sg_format File 39.35 KB 0755
sg_get_config File 35.38 KB 0755
sg_get_elem_status File 26.79 KB 0755
sg_get_lba_status File 22.95 KB 0755
sg_ident File 14.6 KB 0755
sg_inq File 115.61 KB 0755
sg_logs File 146.93 KB 0755
sg_luns File 22.79 KB 0755
sg_map File 18.3 KB 0755
sg_map26 File 26.7 KB 0755
sg_modes File 46.08 KB 0755
sg_opcodes File 35.01 KB 0755
sg_persist File 36.08 KB 0755
sg_prevent File 14.51 KB 0755
sg_raw File 26.91 KB 0755
sg_rbuf File 22.73 KB 0755
sg_rdac File 18.3 KB 0755
sg_read File 26.31 KB 0755
sg_read_attr File 36.65 KB 0755
sg_read_block_limits File 14.54 KB 0755
sg_read_buffer File 27.56 KB 0755
sg_read_long File 14.7 KB 0755
sg_readcap File 22.79 KB 0755
sg_reassign File 18.66 KB 0755
sg_referrals File 14.66 KB 0755
sg_rep_pip File 14.57 KB 0755
sg_rep_zones File 26.8 KB 0755
sg_requests File 22.76 KB 0755
sg_reset File 14.66 KB 0755
sg_reset_wp File 14.6 KB 0755
sg_rmsn File 14.51 KB 0755
sg_rtpg File 14.6 KB 0755
sg_safte File 22.7 KB 0755
sg_sanitize File 27.01 KB 0755
sg_sat_identify File 18.73 KB 0755
sg_sat_phy_event File 19.01 KB 0755
sg_sat_read_gplog File 18.73 KB 0755
sg_sat_set_features File 18.7 KB 0755
sg_scan File 18.38 KB 0755
sg_seek File 18.88 KB 0755
sg_senddiag File 27.2 KB 0755
sg_ses File 119.97 KB 0755
sg_ses_microcode File 27.36 KB 0755
sg_start File 18.85 KB 0755
sg_stpg File 22.73 KB 0755
sg_stream_ctl File 18.7 KB 0755
sg_sync File 14.66 KB 0755
sg_test_rwbuf File 18.6 KB 0755
sg_timestamp File 22.83 KB 0755
sg_turs File 26.7 KB 0755
sg_unmap File 22.76 KB 0755
sg_verify File 22.91 KB 0755
sg_vpd File 118.42 KB 0755
sg_wr_mode File 22.73 KB 0755
sg_write_buffer File 27.23 KB 0755
sg_write_long File 14.76 KB 0755
sg_write_same File 26.95 KB 0755
sg_write_verify File 26.79 KB 0755
sg_write_x File 55.6 KB 0755
sg_xcopy File 42.32 KB 0755
sg_zone File 14.86 KB 0755
sginfo File 76.01 KB 0755
sgitopnm File 18.3 KB 0755
sgm_dd File 34.31 KB 0755
sgp_dd File 46.31 KB 0755
sh File 126.74 KB 0755
sha1sum File 38.41 KB 0755
sha224sum File 38.41 KB 0755
sha256sum File 38.41 KB 0755
sha384sum File 38.41 KB 0755
sha512sum File 38.41 KB 0755
shasum File 9.75 KB 0755
showconsolefont File 18.37 KB 0755
showkey File 18.37 KB 0755
shred File 54.51 KB 0755
shuf File 46.51 KB 0755
sirtopnm File 14.3 KB 0755
sixel2png File 14.3 KB 0755
skill File 26.41 KB 0755
slabtop File 22.44 KB 0755
sldtoppm File 18.35 KB 0755
sleep File 34.51 KB 0755
slogin File 827.04 KB 0755
snap File 20.84 MB 0755
snapctl File 7.37 MB 0755
snapfuse File 38.23 KB 0755
snice File 26.41 KB 0755
socat File 447.68 KB 0755
socat-broker.sh File 2.24 KB 0755
socat-chain.sh File 7.86 KB 0755
socat-mux.sh File 3.47 KB 0755
socat1 File 447.68 KB 0755
soelim File 34.48 KB 0755
sort File 102.8 KB 0755
sos File 612 B 0755
sos-collector File 1.04 KB 0755
sosreport File 1.03 KB 0755
sotruss File 4.21 KB 0755
spctoppm File 14.3 KB 0755
splain File 18.99 KB 0755
split File 54.94 KB 0755
splitfont File 14.3 KB 0755
spottopgm File 14.31 KB 0755
sprof File 34.44 KB 0755
sputoppm File 14.3 KB 0755
sqfscat File 147.9 KB 0755
sqfstar File 286.95 KB 0755
srftopam File 18.3 KB 0755
ss File 129.07 KB 0755
ssh File 827.04 KB 0755
ssh-add File 294.42 KB 0755
ssh-agent File 302.43 KB 2755
ssh-argv0 File 1.42 KB 0755
ssh-copy-id File 12.77 KB 0755
ssh-import-id File 985 B 0755
ssh-import-id-gh File 785 B 0755
ssh-import-id-lp File 785 B 0755
ssh-keygen File 442.44 KB 0755
ssh-keyscan File 330.44 KB 0755
st4topgm File 14.3 KB 0755
stat File 86.52 KB 0755
static-sh File 2.03 MB 0755
stdbuf File 50.51 KB 0755
strace File 1.99 MB 0755
strace-log-merge File 1.78 KB 0755
stream File 14.31 KB 0755
stream-im6 File 14.31 KB 0755
stream-im6.q16 File 14.31 KB 0755
streamzip File 7.87 KB 0755
stty File 78.52 KB 0755
su File 54.38 KB 4755
sudo File 271.42 KB 4755
sudoedit File 271.42 KB 4755
sudoreplay File 95.95 KB 0755
sum File 34.41 KB 0755
sunicontopnm File 14.3 KB 0755
svgtopam File 22.3 KB 0755
sync File 34.41 KB 0755
systemctl File 1.43 MB 0755
systemd File 98.45 KB 0755
systemd-ac-power File 14.45 KB 0755
systemd-analyze File 198.85 KB 0755
systemd-ask-password File 18.58 KB 0755
systemd-cat File 18.45 KB 0755
systemd-cgls File 22.57 KB 0755
systemd-cgtop File 38.47 KB 0755
systemd-confext File 54.64 KB 0755
systemd-creds File 42.72 KB 0755
systemd-cryptenroll File 70.92 KB 0755
systemd-cryptsetup File 78.95 KB 0755
systemd-delta File 26.45 KB 0755
systemd-detect-virt File 18.45 KB 0755
systemd-escape File 22.45 KB 0755
systemd-firstboot File 58.82 KB 0755
systemd-hwdb File 154.74 KB 0755
systemd-id128 File 22.45 KB 0755
systemd-inhibit File 22.47 KB 0755
systemd-machine-id-setup File 18.63 KB 0755
systemd-mount File 50.78 KB 0755
systemd-notify File 26.66 KB 0755
systemd-path File 18.45 KB 0755
systemd-repart File 195.23 KB 0755
systemd-run File 66.79 KB 0755
systemd-socket-activate File 30.45 KB 0755
systemd-stdio-bridge File 22.45 KB 0755
systemd-sysext File 54.64 KB 0755
systemd-sysusers File 66.63 KB 0755
systemd-tmpfiles File 114.7 KB 0755
systemd-tty-ask-password-agent File 34.45 KB 0755
systemd-umount File 50.78 KB 0755
tabs File 18.3 KB 0755
tac File 38.41 KB 0755
tail File 62.53 KB 0755
tapestat File 26.44 KB 0755
tar File 421.92 KB 0755
taskset File 30.38 KB 0755
tbl File 134.48 KB 0755
tclsh File 14.15 KB 0755
tclsh8.6 File 14.15 KB 0755
tcpdump File 1.21 MB 0755
tee File 38.51 KB 0755
telnet File 177.85 KB 0755
tempfile File 14.3 KB 0755
test File 46.44 KB 0755
tgatoppm File 18.3 KB 0755
thinkjettopbm File 18.3 KB 0755
tic File 90.41 KB 0755
tifftopnm File 42.38 KB 0755
time File 26.52 KB 0755
timedatectl File 46.45 KB 0755
timeout File 38.95 KB 0755
tkconch3 File 227 B 0755
tload File 22.39 KB 0755
tmux File 1.05 MB 0755
tnftp File 182.9 KB 0755
toe File 22.3 KB 0755
toilet File 26.68 KB 0755
top File 131.7 KB 0755
touch File 94.51 KB 0755
tput File 26.34 KB 0755
tr File 46.51 KB 0755
trace-cmd File 435.41 KB 0755
tracepath File 18.15 KB 0755
trial3 File 219 B 0755
troff File 726.62 KB 0755
true File 26.3 KB 0755
truncate File 38.51 KB 0755
tset File 26.31 KB 0755
tsort File 46.51 KB 0755
tty File 34.51 KB 0755
turbostat File 1.58 KB 0755
twist3 File 239 B 0755
twistd3 File 220 B 0755
tzselect File 15.02 KB 0755
ua File 1003 B 0755
ubuntu-advantage File 1003 B 0755
ubuntu-bug File 2.27 KB 0755
ubuntu-distro-info File 26.89 KB 0755
ubuntu-drivers File 18.97 KB 0755
ubuntu-security-status File 22.25 KB 0755
ucf File 40.68 KB 0755
ucfq File 18.91 KB 0755
ucfr File 10.85 KB 0755
uclampset File 30.38 KB 0755
ucs2any File 26.15 KB 0755
udevadm File 1.37 MB 0755
udisksctl File 62.38 KB 0755
ul File 22.38 KB 0755
umount File 38.38 KB 4755
uname File 34.51 KB 0755
unattended-upgrade File 97.21 KB 0755
unattended-upgrades File 97.21 KB 0755
uncompress File 2.29 KB 0755
unexpand File 38.53 KB 0755
unicode_start File 2.71 KB 0755
unicode_stop File 528 B 0755
uniq File 38.51 KB 0755
unlink File 34.51 KB 0755
unlzma File 86.92 KB 0755
unminimize File 5.59 KB 0755
unmkinitramfs File 3.7 KB 0755
unshare File 42.6 KB 0755
unsquashfs File 147.9 KB 0755
unxz File 86.92 KB 0755
unzip File 174.42 KB 0755
unzipsfx File 74.42 KB 0755
unzstd File 998.79 KB 0755
update-alternatives File 58.38 KB 0755
update-mime-database File 74.33 KB 0755
upower File 14.3 KB 0755
uptime File 14.38 KB 0755
usb-devices File 4.83 KB 0755
usbhid-dump File 30.38 KB 0755
usbip File 1.58 KB 0755
usbipd File 1.58 KB 0755
usbreset File 14.3 KB 0755
users File 34.51 KB 0755
utmpdump File 22.38 KB 0755
uuidgen File 18.38 KB 0755
uuidparse File 22.38 KB 0755
varlinkctl File 30.45 KB 0755
vcs-run File 6.75 KB 0755
vdir File 138.98 KB 0755
vi File 3.94 MB 0755
view File 3.94 MB 0755
vigpg File 2.58 KB 0755
vim File 3.94 MB 0755
vim.basic File 3.94 MB 0755
vim.tiny File 1.66 MB 0755
vimdiff File 3.94 MB 0755
vimtutor File 2.1 KB 0755
vm-support File 9.83 KB 0755
vmhgfs-fuse File 46.73 KB 0755
vmstat File 38.78 KB 0755
vmtoolsd File 74.56 KB 0755
vmware-alias-import File 42.52 KB 0755
vmware-checkvm File 14.38 KB 0755
vmware-hgfsclient File 14.38 KB 0755
vmware-namespace-cmd File 22.3 KB 0755
vmware-rpctool File 18.3 KB 0755
vmware-toolbox-cmd File 54.59 KB 0755
vmware-vgauth-cmd File 18.3 KB 0755
vmware-vmblock-fuse File 22.78 KB 0755
vmware-xferlogs File 32.33 KB 0755
w File 26.38 KB 0755
w3m File 1.58 MB 0755
w3mman File 1.37 KB 0755
wall File 22.38 KB 0755
watch File 30.84 KB 0755
watchgnupg File 22.3 KB 0755
wbmptopbm File 14.3 KB 0755
wc File 54.52 KB 0755
wcmgr File 26.2 KB 0755
wdctl File 34.4 KB 0755
webalizer File 212.35 KB 0755
webazolver File 212.35 KB 0755
wget File 459.02 KB 0755
whatis File 47.28 KB 0755
whereis File 30.84 KB 0755
which File 1.05 KB 0755
which.debianutils File 1.05 KB 0755
whiptail File 30.16 KB 0755
who File 58.52 KB 0755
whoami File 34.51 KB 0755
whois File 155.66 KB 0755
wifi-status File 2.06 KB 0755
winicontopam File 22.3 KB 0755
winicontoppm File 18.3 KB 0755
write File 22.38 KB 0755
wsrep_sst_backup File 2.39 KB 0755
wsrep_sst_common File 66.86 KB 0755
wsrep_sst_mariabackup File 49.23 KB 0755
wsrep_sst_mysqldump File 8.11 KB 0755
wsrep_sst_rsync File 29.72 KB 0755
wsrep_sst_rsync_wan File 29.72 KB 0755
www-browser File 1.58 MB 0755
x86_64 File 26.65 KB 0755
x86_energy_perf_policy File 1.58 KB 0755
xargs File 62.41 KB 0755
xauth File 54.96 KB 0755
xbmtopbm File 14.3 KB 0755
xdg-user-dir File 234 B 0755
xdg-user-dirs-update File 26.23 KB 0755
ximtoppm File 14.3 KB 0755
xpmtoppm File 18.35 KB 0755
xsubpp File 5.05 KB 0755
xvminitoppm File 14.3 KB 0755
xwdtopnm File 26.3 KB 0755
xxd File 22.28 KB 0755
xz File 86.92 KB 0755
xzcat File 86.92 KB 0755
xzcmp File 7.25 KB 0755
xzdiff File 7.25 KB 0755
xzegrep File 10.09 KB 0755
xzfgrep File 10.09 KB 0755
xzgrep File 10.09 KB 0755
xzless File 1.77 KB 0755
xzmore File 2.14 KB 0755
ybmtopbm File 14.3 KB 0755
yes File 34.38 KB 0755
ypdomainname File 22.23 KB 0755
yuvsplittoppm File 14.3 KB 0755
yuvtoppm File 14.3 KB 0755
yuy2topam File 14.3 KB 0755
zcat File 1.94 KB 0755
zcmp File 1.64 KB 0755
zdiff File 6.31 KB 0755
zdump File 30.28 KB 0755
zegrep File 29 B 0755
zeisstopnm File 14.3 KB 0755
zfgrep File 29 B 0755
zforce File 2.03 KB 0755
zgrep File 7.91 KB 0755
zip File 206.98 KB 0755
zipcloak File 70.4 KB 0755
zipdetails File 68.55 KB 0755
zipgrep File 2.89 KB 0755
zipinfo File 174.42 KB 0755
zipnote File 62.4 KB 0755
zipsplit File 58.4 KB 0755
zless File 2.15 KB 0755
zmore File 1.8 KB 0755
znew File 4.47 KB 0755
zstd File 998.79 KB 0755
zstdcat File 998.79 KB 0755
zstdgrep File 3.78 KB 0755
zstdless File 197 B 0755
zstdmt File 998.79 KB 0755
Filemanager